DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and MEE56

DIOPT Version :10

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_193074.1 Gene:MEE56 / 826969 AraportID:AT4G13380 Length:195 Species:Arabidopsis thaliana


Alignment Length:79 Identity:21/79 - (26%)
Similarity:39/79 - (49%) Gaps:9/79 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVEMTCGGCASAVERVLGKLGDKVEKV---NINLEDRTVSVTSNLSSD----ELMEQLRKTGKST 64
            |:|:.....:...|..:||:..|.|.|   .:::|::.|.:|.:...:    ||.|::||  :..
plant    80 KLEIHIAFLSEKYEADIGKVISKFEGVKTCKVDVENKKVVITGDFDEEKLWKELEEKMRK--RIV 142

  Fly    65 TYVGVKKXDEFLSK 78
            .....|| ||.::|
plant   143 KMEKEKKDDEPITK 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 CopZ 1..61 CDD:442020 16/60 (27%)
MEE56NP_193074.1 HMA 90..>125 CDD:459804 9/34 (26%)

Return to query results.
Submit another query.