DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and CCH

DIOPT Version :9

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_191183.1 Gene:CCH / 824790 AraportID:AT3G56240 Length:121 Species:Arabidopsis thaliana


Alignment Length:68 Identity:27/68 - (39%)
Similarity:44/68 - (64%) Gaps:1/68 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGKSTTYVGVKK 71
            ||.|:|.||..||.|||||: :.||..:|:::::.|:|..|:..:.:.:.:.||||.|:|..|:.
plant     8 KVGMSCQGCVGAVNRVLGKM-EGVESFDIDIKEQKVTVKGNVEPEAVFQTVSKTGKKTSYWPVEA 71

  Fly    72 XDE 74
             .|
plant    72 EAE 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 CopZ 1..61 CDD:442020 20/53 (38%)
CCHNP_191183.1 HMA 10..65 CDD:238219 21/55 (38%)

Return to query results.
Submit another query.