DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atox1 and CCH

Sequence 1:NP_001262184.1 Gene:Atox1 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001326128.1 Gene:CCH AraportID:AT3G56240 Length:121 Species:Arabidopsis thaliana

Alignment Length:68 Identity:27/69 (39%)
Similarity:44/69 (64%) Gaps:1/69 (1%)


  Fly     7 KVEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGKSTTYVGVKK 71
            ||.|:|.||..||.|||||: :.||..:|:::::.|:|..|:..:.:.:.:.||||.|:|..|:.
plant     8 KVGMSCQGCVGAVNRVLGKM-EGVESFDIDIKEQKVTVKGNVEPEAVFQTVSKTGKKTSYWPVEA 71

  Fly    72 XDE 74
             .|
plant    72 EAE 74

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 HMA 5..62 CDD:238219 22/55 (40%)
CCHNP_001326128.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1564517at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130576
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.812 Consistency score
43.820

Return to query results.
Submit another query.