DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and AT3G48970

DIOPT Version :10

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_566913.1 Gene:AT3G48970 / 824058 AraportID:AT3G48970 Length:140 Species:Arabidopsis thaliana


Alignment Length:84 Identity:25/84 - (29%)
Similarity:44/84 - (52%) Gaps:4/84 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTVHEFKV-EMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTS-NLSSDELMEQLRKTGKS 63
            ||| |.:| .:.|.||||.:.:.|.|| ..||:|.:.:|.:.|:... .|...::::.:|:.||:
plant     3 MTV-EIRVPNLDCEGCASKLRKTLLKL-KGVEEVEVEMETQKVTARGYRLEEKKVLKAVRRAGKA 65

  Fly    64 TTYVGVKKXDEFLSKFQKY 82
            ......:. :...:.|.||
plant    66 AELWPYRLGNSHFASFYKY 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 CopZ 1..61 CDD:442020 20/61 (33%)
AT3G48970NP_566913.1 None

Return to query results.
Submit another query.