DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and AT3G56891

DIOPT Version :10

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001118849.1 Gene:AT3G56891 / 6240272 AraportID:AT3G56891 Length:166 Species:Arabidopsis thaliana


Alignment Length:66 Identity:21/66 - (31%)
Similarity:42/66 - (63%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTVHEFKVEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGKSTT 65
            :::.|..|:|.|.||...|.|.:.|| |.|:.|.|:::.:.|:||..:..:|:::.:::||::..
plant    15 LSIVELLVDMDCKGCEKKVRRAISKL-DGVDTVEIDVDRQKVTVTGYVDREEVLKMVKRTGRTAE 78

  Fly    66 Y 66
            |
plant    79 Y 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 CopZ 1..61 CDD:442020 18/59 (31%)
AT3G56891NP_001118849.1 HMA 24..78 CDD:238219 18/54 (33%)

Return to query results.
Submit another query.