powered by:
Protein Alignment Atox1 and atox1
DIOPT Version :9
| Sequence 1: | NP_001262184.1 |
Gene: | Atox1 / 326216 |
FlyBaseID: | FBgn0052446 |
Length: | 89 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001243562.1 |
Gene: | atox1 / 558347 |
ZFINID: | ZDB-GENE-120720-2 |
Length: | 67 |
Species: | Danio rerio |
| Alignment Length: | 70 |
Identity: | 35/70 - (50%) |
| Similarity: | 49/70 - (70%) |
Gaps: | 3/70 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MTVHEFKVEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGKSTT 65
||.|||.|:|||.||:.||.|||.||. .|.:|:|.::.|.:.|:.::|.|:|.|:||||:.|
Zfish 1 MTTHEFFVDMTCEGCSGAVTRVLNKLD---VKFDIDLPNKKVFIESDKNTDVLLETLKKTGKTVT 62
Fly 66 YVGVK 70
|:|.|
Zfish 63 YIGTK 67
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| Atox1 | NP_001262184.1 |
HMA |
5..62 |
CDD:238219 |
26/56 (46%) |
| atox1 | NP_001243562.1 |
HMA |
10..62 |
CDD:238219 |
25/54 (46%) |
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
1 |
1.000 |
50 |
1.000 |
Domainoid score |
I11762 |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1603 |
| Hieranoid |
1 |
1.000 |
- |
- |
|
|
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
1 |
1.050 |
70 |
1.000 |
Inparanoid score |
I5321 |
| OMA |
1 |
1.010 |
- |
- |
|
QHG50019 |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0005753 |
| OrthoInspector |
1 |
1.000 |
- |
- |
|
oto41334 |
| orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_103475 |
| Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR46365 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R124 |
| SonicParanoid |
1 |
1.000 |
- |
- |
|
X3080 |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
1 |
0.960 |
- |
- |
|
|
| ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
13 | 12.860 |
|
Return to query results.
Submit another query.