DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atox1 and atox1

Sequence 1:NP_001262184.1 Gene:Atox1 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001243562.1 Gene:atox1 ZFINID:ZDB-GENE-120720-2 Length:67 Species:Danio rerio

Alignment Length:70 Identity:35/71 (49%)
Similarity:49/71 (69%) Gaps:3/71 (4%)


  Fly     1 MTVHEFKVEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGKSTT 65
            ||.|||.|:|||.||:.||.|||.||.   .|.:|:|.::.|.:.|:.::|.|:|.|:||||:.|
Zfish     1 MTTHEFFVDMTCEGCSGAVTRVLNKLD---VKFDIDLPNKKVFIESDKNTDVLLETLKKTGKTVT 62

  Fly    66 YVGVK 70
            |:|.|
Zfish    63 YIGTK 67

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 HMA 5..62 CDD:238219 27/57 (47%)
atox1NP_001243562.1 HMA 10..62 CDD:238219 25/55 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1603
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I5234
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004179
OrthoInspector 1 1.000 T1051849
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR46365
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R124
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
99.050

Return to query results.
Submit another query.