powered by:
Protein Alignment Atox1 and AT5G05365
DIOPT Version :9
| Sequence 1: | NP_001262184.1 |
Gene: | Atox1 / 326216 |
FlyBaseID: | FBgn0052446 |
Length: | 89 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001078533.1 |
Gene: | AT5G05365 / 5008200 |
AraportID: | AT5G05365 |
Length: | 77 |
Species: | Arabidopsis thaliana |
| Alignment Length: | 61 |
Identity: | 16/61 - (26%) |
| Similarity: | 35/61 - (57%) |
Gaps: | 1/61 - (1%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 3 VHEFKVEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGKS 63
|.|.||.:.|..|...:.:.:.|:.| :|..:::.:...|:||.|::.::::..|:|..|:
plant 4 VVELKVNLHCDECIRKILKAIKKIED-IEAYDVDTQLNKVTVTGNVTEEQVIRVLQKVRKA 63
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| Atox1 | NP_001262184.1 |
HMA |
5..62 |
CDD:238219 |
14/56 (25%) |
| AT5G05365 | NP_001078533.1 |
HMA |
8..62 |
CDD:395326 |
13/54 (24%) |
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
1 |
1.000 |
- |
- |
|
|
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.