DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atox1 and AT5G05365

Sequence 1:NP_001262184.1 Gene:Atox1 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001078533.1 Gene:AT5G05365 AraportID:AT5G05365 Length:77 Species:Arabidopsis thaliana

Alignment Length:61 Identity:16/62 (26%)
Similarity:35/62 (56%) Gaps:1/62 (2%)


  Fly     3 VHEFKVEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGKS 63
            |.|.||.:.|..|...:.:.:.|:.| :|..:::.:...|:||.|::.::::..|:|..|:
plant     4 VVELKVNLHCDECIRKILKAIKKIED-IEAYDVDTQLNKVTVTGNVTEEQVIRVLQKVRKA 63

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 HMA 5..62 CDD:238219 14/57 (25%)
AT5G05365NP_001078533.1 HMA 8..62 CDD:278815 13/55 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
21.910

Return to query results.
Submit another query.