DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32379 and CG17633

Sequence 1:NP_729252.2 Gene:CG32379 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_609310.2 Gene:CG17633 FlyBaseID:FBgn0032144 Length:430 Species:Drosophila melanogaster

Alignment Length:302 Identity:110/303 (36%)
Similarity:162/303 (53%) Gaps:10/303 (3%)


  Fly    44 FYTHSEINDYLDSLLERFPKRVQVKQFGWSYERRPLKVLTITNGDGRRN---KPVILIDGTVHAR 105
            :|...:...:|.||.:..|..|.:.:.|.:|:.|.:..:.||.|....|   ||.|.::..:|||
  Fly   125 YYELDDTYAWLQSLAQTNPGVVTLIEGGKTYQGRSILGVKITKGGETINGKAKPGIFLEAGIHAR 189

  Fly   106 EWISPSMALYIIQQLLDNYGDN-QELLQDYDWVIMPVVNADGYEYTHTDSRYWRKSRRPTSNPEC 169
            |||:|:.|.:||.|||.:..:| :||.::|.|.::|..|.|||.||||.:|.|||:|.|..:  |
  Fly   190 EWIAPAAATFIINQLLTSEVENIKELAENYTWYVLPHANPDGYVYTHTTNRLWRKTRTPYGS--C 252

  Fly   170 IGTDINRNFGYEWGHDEGSSSDPCENIYRGERPFDQSESQVLRDVMLHYKGRLNFYLSLHSYGNY 234
            .|.|.|||:|:.| ::.|:||..|.:.|.|...|.:.|:..|...:...||::..|||||:|..|
  Fly   253 FGADPNRNWGFHW-NEVGASSSACSDTYAGPSAFSEIETLSLSKFIEGLKGKVQLYLSLHAYSQY 316

  Fly   235 FLLPWGYTSDFPDTYQDMMSVADAGAKAIIYSTNGIYSYGSTYYVLYPTSGDTTDFAFGVVNATV 299
            .|.|:|:|||.||...|...|.||...|:.......|:.|:.|..:||.:|.:.|:|:|..:..:
  Fly   317 LLYPYGHTSDLPDNVADFEKVFDASIAAVNKRYGTTYTGGNIYDAIYPAAGASVDWAYGTQDVRM 381

  Fly   300 AMTMELPAAG---FQGFDPWISQIERLVTESWVGVRAMAAEV 338
            |...||..:.   ..||.....||.....|....:.|||.||
  Fly   382 AFCYELRPSSTSYLTGFKLPAEQIVPASEELLDSIVAMATEV 423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 109/301 (36%)
CG17633NP_609310.2 MpaA 7..374 CDD:225421 96/252 (38%)
Propep_M14 34..105 CDD:280416
M14_CP_A-B_like 125..423 CDD:199844 109/301 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70164421
eggNOG 1 0.900 E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I2432
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11705
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.