DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11583 and BRX1

Sequence 1:NP_001033989.1 Gene:CG11583 FlyBaseID:FBgn0035524 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_014565.2 Gene:BRX1 SGDID:S000005437 Length:291 Species:Saccharomyces cerevisiae

Alignment Length:285 Identity:120/286 (42%)
Similarity:181/286 (63%) Gaps:24/286 (8%)


  Fly    31 RSSDDVVPKKE----KWVNKQRVLVFSARGISHRDRHLMKDIKTLMPHHRPESKMERSKTLSVVN 91
            :|.|:...||:    :::||||.|:.|:||:::|.|||::|:..|:||.|.|.|::..|.|..:|
Yeast    11 KSKDNKSEKKQGNVKQFMNKQRTLLISSRGVNYRHRHLIQDLSGLLPHSRKEPKLDTKKDLQQLN 75

  Fly    92 EMCEMKHCNKAMLFEGRRKRDLYMWISNTSGSTGPSAKFLIENIHTMAELKMTGNCLRGSRPLLS 156
            |:.|:.:||..:.||.|:.:|||:|:|..  ..||:.||.|:|:|||.||..|||||:||||:||
Yeast    76 EIAELYNCNNVLFFEARKHQDLYLWLSKP--PNGPTIKFYIQNLHTMDELNFTGNCLKGSRPVLS 138

  Fly   157 FDSKFDELPHLKLLKELFVQTYSVPNHHPKSQPFVDHVFTFTYLDKRIWFRNFQIL--------- 212
            ||.:|:..||.:|:|||.|..:.||.:..||:||:|||.:|:.:|.:||.|.::|.         
Yeast   139 FDQRFESSPHYQLIKELLVHNFGVPPNARKSKPFIDHVMSFSIVDDKIWVRTYEISHSTKNKEEY 203

  Fly   213 ---SEDGGLSEVGPRYVMNPVKIFDGSFTGKTIWENPDYVSPSKQRQVLKKAAKDKYVNR----V 270
               .||..|.|:|||:||..:.|.:|||.|..|:||..||||:..|..:|:.|.::..:|    |
Yeast   204 EDGEEDISLVEIGPRFVMTVILILEGSFGGPKIYENKQYVSPNVVRAQIKQQAAEEAKSRAEAAV 268

  Fly   271 EQKVKHEATRPIRAYDGMDNDELFE 295
            |:|:|....  :.|.|.:.||.||:
Yeast   269 ERKIKRREN--VLAADPLSNDALFK 291

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11583NP_001033989.1 Brix 43..290 CDD:294606 112/263 (43%)
BRX1NP_014565.2 BRX1 1..291 CDD:227483 120/284 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C149000022
eggNOG 1 0.900 E1_COG5154
Hieranoid 1 1.000
Homologene 1 1.000 H10133
Inparanoid 1 1.050 237 1.000 Inparanoid score I696
Isobase 1 0.950 0 Normalized mean entropy S699
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003889
OrthoInspector 1 1.000 T1136820
orthoMCL 1 0.900 OOG5_127903
Panther 1 1.100 LDO PTHR13634
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R149
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.