DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11583 and AT1G52930

Sequence 1:NP_001033989.1 Gene:CG11583 FlyBaseID:FBgn0035524 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_564618.1 Gene:AT1G52930 AraportID:AT1G52930 Length:320 Species:Arabidopsis thaliana

Alignment Length:328 Identity:133/329 (40%)
Similarity:199/329 (60%) Gaps:38/329 (12%)


  Fly     1 MGRKFQNKKKKA-APQLEIVPLDENPPLPPQRS----SDDVVPKKEK--------WVNKQRVLVF 52
            ||||.::.:.:| ||   :...||..|..|:|:    .|....:.||        :.||::|||.
plant     1 MGRKRKHSETEAPAP---VKKSDEPAPDRPKRTLLGWKDKSEGEAEKAKALTSSGFKNKEKVLVT 62

  Fly    53 SARGISHRDRHLMKDIKTLMPHHRPESKME-RSKTLSVVNEMCEMKHCNKAMLFEGRRKRDLYMW 116
            .:|.||.|.|.||.:|.:|:||.:.:||:| :|...:.:||:.|:|:.|..:.||.|:.:|||||
plant    63 CSRRISFRYRSLMLNIVSLLPHCKKDSKVEAKSSKGATLNELIELKNSNSCLFFECRKHKDLYMW 127

  Fly   117 ISNTSGSTGPSAKFLIENIHTMAELKMTGNCLRGSRPLLSFDSKFDELPHLKLLKELFVQTYSVP 181
            :  .....|||.|||::.:|.|.|:|:|||.|:||||||:|.|.||:..|.|||||:..|.:.:|
plant   128 M--VKSPNGPSVKFLVKAVHAMEEMKLTGNHLKGSRPLLTFSSNFDKDAHWKLLKEMLTQVFGIP 190

  Fly   182 NHHPKSQPFVDHVFTFTYLDKRIWFRNFQIL----SED----GGLS-----EVGPRYVMNPVKIF 233
            ..|.||:|:.||||.|:.:|:.|||||:||.    ..|    |||.     |||||:.:||:|||
plant   191 KEHRKSKPYHDHVFVFSIVDEHIWFRNYQISVPHNESDKIAKGGLDKMTLIEVGPRFCLNPIKIF 255

  Fly   234 DGSFTGKTIWENPDYVSPSKQRQVLKKAAKDKYVNRVEQKVK---HEATRPIRAYDGMDNDELFE 295
            .|||.|.|::|||.||||::.|.:.|:....|:..:::.|.:   ||.:.|:...:..|   :::
plant   256 AGSFGGPTLYENPLYVSPNQIRALEKRNKAGKFAKKIKAKTRKKMHELSNPLEPDEFAD---MWK 317

  Fly   296 DDD 298
            ||:
plant   318 DDE 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11583NP_001033989.1 Brix 43..290 CDD:294606 116/264 (44%)
AT1G52930NP_564618.1 Brix 37..317 CDD:294606 118/285 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H10133
Inparanoid 1 1.050 228 1.000 Inparanoid score I1118
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T124211
orthoMCL 1 0.900 OOG5_127903
Panther 1 1.100 LDO PTHR13634
Phylome 1 0.910 0.667 Consistency score
87.970

Return to query results.
Submit another query.