DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11583 and AT3G15460

Sequence 1:NP_001033989.1 Gene:CG11583 FlyBaseID:FBgn0035524 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_566514.1 Gene:AT3G15460 AraportID:AT3G15460 Length:315 Species:Arabidopsis thaliana

Alignment Length:322 Identity:128/323 (40%)
Similarity:193/323 (60%) Gaps:37/323 (11%)


  Fly     1 MGRKFQNKKKKAAPQLEIVPLDENPPLPPQRS-------SDDVVPKKEKWV----NKQRVLVFSA 54
            |||     |:|.:..:...|:.::.|..|||:       .:|....|..:.    ||::|||..:
plant     1 MGR-----KRKHSETVTAAPVKDSAPERPQRTLLGWKDKKEDAENSKPAYASVFRNKEKVLVTCS 60

  Fly    55 RGISHRDRHLMKDIKTLMPHHRPESKME-RSKTLSVVNEMCEMKHCNKAMLFEGRRKRDLYMWIS 118
            |.|:.|.||||.::.:|:||.:.:||:| :|...:.:||:.|:|..:..:.||.|:.:|||||:.
plant    61 RRINFRYRHLMLNMVSLLPHCKKDSKVEAKSSRGATLNELIELKGSSSCLFFECRKHKDLYMWMV 125

  Fly   119 NTSGSTGPSAKFLIENIHTMAELKMTGNCLRGSRPLLSFDSKFDELPHLKLLKELFVQTYSVPNH 183
            .:.|  |||.|||:..:|||.|||:|||.|:||||||:|.|.|:...|.|||||:..|.:.:|..
plant   126 KSPG--GPSVKFLVNAVHTMEELKLTGNHLKGSRPLLTFSSNFENDAHWKLLKEMLTQIFGIPEG 188

  Fly   184 HPKSQPFVDHVFTFTYLDKRIWFRNFQIL---SEDGGLS----------EVGPRYVMNPVKIFDG 235
            |.||:|:.||||.|:.:|..|||||:||.   :|...::          |||||:.:||:|||.|
plant   189 HRKSKPYHDHVFVFSIVDDHIWFRNYQISVPHNESDKIARGDLDKMTLIEVGPRFCLNPIKIFGG 253

  Fly   236 SFTGKTIWENPDYVSPSKQRQVLKKAAKDKYVNRVEQKVK---HEATRPIR--AYDGMDNDE 292
            ||.|.|::|||.||||::.|.:.|:....|:..:::.|.:   ||.:.|:.  .:..|.|||
plant   254 SFGGTTLYENPFYVSPNQIRALEKRNKAGKFAKKIKAKTRRKMHELSNPLEPDEFTDMWNDE 315

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11583NP_001033989.1 Brix 43..290 CDD:294606 113/270 (42%)
AT3G15460NP_566514.1 Brix 28..312 CDD:294606 115/286 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H10133
Inparanoid 1 1.050 228 1.000 Inparanoid score I1118
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T124211
orthoMCL 1 0.900 OOG5_127903
Panther 1 1.100 O PTHR13634
Phylome 1 0.910 0.667 Consistency score
87.970

Return to query results.
Submit another query.