DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11583 and brix1

Sequence 1:NP_001033989.1 Gene:CG11583 FlyBaseID:FBgn0035524 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001039219.2 Gene:brix1 XenbaseID:XB-GENE-1007993 Length:339 Species:Xenopus tropicalis

Alignment Length:352 Identity:167/353 (47%)
Similarity:226/353 (64%) Gaps:31/353 (9%)


  Fly     8 KKKK---AAPQLEIVPLDENPPLPPQRSS---DDVVPK---KEKWVNKQRVLVFSARGISHRDRH 63
            |:|:   |.|.:......:.||...|..:   :..|||   ..||.||:|||:||:|||:.|.||
 Frog     5 KRKRGSLAEPAINTKKAKKQPPGTQQEGAAGEEFTVPKPVSAGKWKNKERVLIFSSRGINFRTRH 69

  Fly    64 LMKDIKTLMPHHRPESKMERSKTLSVVNEMCEMKHCNKAMLFEGRRKRDLYMWISNTSGSTGPSA 128
            ||:|::|||||.:.|:||:|...|.||||:||||:|||.:.||.::|:|||||:||:  ..||||
 Frog    70 LMQDLRTLMPHTKAETKMDRKDKLFVVNEVCEMKNCNKCIYFEAKKKQDLYMWLSNS--PEGPSA 132

  Fly   129 KFLIENIHTMAELKMTGNCLRGSRPLLSFDSKFDELPHLKLLKELFVQTYSVPNHHPKSQPFVDH 193
            |||::||||:|||||:||||:||||:||||..||..||..|||||..|.:..|.:||:|||||||
 Frog   133 KFLVQNIHTLAELKMSGNCLKGSRPILSFDPAFDRDPHYALLKELLTQIFGTPRYHPRSQPFVDH 197

  Fly   194 VFTFTYLDKRIWFRNFQILSEDGGLSEVGPRYVMNPVKIFDGSFTGKTIWENPDYVSPSKQRQVL 258
            ||||:..|.||||||:|::.||..|.|:|||:|:|.:|||.|||.|.|::|||.|.||:..|:::
 Frog   198 VFTFSIADNRIWFRNYQVIEEDAALVEIGPRFVLNLIKIFKGSFGGPTLYENPHYQSPNMHRRMI 262

  Fly   259 K--KAAKDKYVNRVE--QKVKHEATRPIRAYDGMDNDELFEDDDPVETAKILAAIAKKKKEEAAK 319
            :  .|||.|...:|:  ||:|.|..||:            ...||.|:.....|..|.:..|...
 Frog   263 RMATAAKVKEKQQVKELQKMKKEEDRPV------------IPADPTESVFYTPAEEKPQTIETEP 315

  Fly   320 QTPKSALTKKIKEKQLQAVKDVIERKK 346
            ..||    .|:|.|..|..:..:.:|:
 Frog   316 PAPK----PKVKRKDKQFKRQRMAKKR 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11583NP_001033989.1 Brix 43..290 CDD:294606 143/251 (57%)
brix1NP_001039219.2 Brix 51..300 CDD:294606 145/263 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C148994417
eggNOG 1 0.900 E1_COG5154
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H10133
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003889
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.710

Return to query results.
Submit another query.