DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11583 and Brix1

Sequence 1:NP_001033989.1 Gene:CG11583 FlyBaseID:FBgn0035524 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_080672.3 Gene:Brix1 MGIID:1915082 Length:353 Species:Mus musculus

Alignment Length:361 Identity:164/362 (45%)
Similarity:230/362 (64%) Gaps:36/362 (10%)


  Fly     2 GRKFQNKKKKAAPQLEIVPLDENPPL-------PPQRSSDDVVPK---KEKWVNKQRVLVFSARG 56
            |.:.|.||.|.:.:      |...|.       ..:..:.|.:|.   |.||.||:|:|:||:||
Mouse    11 GLEVQAKKPKRSSK------DAGQPAKQADVAKEAEEENRDRIPGPVCKGKWKNKERILIFSSRG 69

  Fly    57 ISHRDRHLMKDIKTLMPHHRPESKMERSKTLSVVNEMCEMKHCNKAMLFEGRRKRDLYMWISNTS 121
            |:.|.||||:|::.||||.:.::||:|...|.|:||:||||:|||.:.||.::|:|||||:||: 
Mouse    70 INFRTRHLMQDLRMLMPHSKADTKMDRKDKLFVINEVCEMKNCNKCIYFEAKKKQDLYMWLSNS- 133

  Fly   122 GSTGPSAKFLIENIHTMAELKMTGNCLRGSRPLLSFDSKFDELPHLKLLKELFVQTYSVPNHHPK 186
             ..|||||||::||||:||||||||||:|||||||||..||:|||..||||..:|.:|.|.:|||
Mouse   134 -PHGPSAKFLVQNIHTLAELKMTGNCLKGSRPLLSFDPAFDDLPHYALLKEFLIQIFSTPRYHPK 197

  Fly   187 SQPFVDHVFTFTYLDKRIWFRNFQILSEDGGLSEVGPRYVMNPVKIFDGSFTGKTIWENPDYVSP 251
            ||||||||||||.||.|||||||||:.||..|.|:|||:|:|.:|||.|||.|.|::|||.|.||
Mouse   198 SQPFVDHVFTFTILDNRIWFRNFQIIEEDAALVEIGPRFVLNLIKIFQGSFGGPTLYENPHYQSP 262

  Fly   252 SKQRQVLKKAAKDKYVNRVE----QKVKHEATRPIRAYDGMDNDELFEDDDPVETAKILAAIAKK 312
            :..|:|::.....||..|.:    ||::.:..:.|..:|              .||.:....|::
Mouse   263 NMHRRVIRSITAAKYRERQQVKDVQKLRKKEPKTILPHD--------------PTADVFVIPAEE 313

  Fly   313 KKEEAAKQTPKSALTKKIKEKQLQAVKDVIERKKAR 348
            |..|.....|:..:..|.:::::......:::|.:|
Mouse   314 KPVEIQWVKPEPKVDLKARKRRIYKRHRKLQQKMSR 349

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11583NP_001033989.1 Brix 43..290 CDD:294606 144/251 (57%)
Brix1NP_080672.3 Brix 36..307 CDD:294606 150/287 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C148991916
eggNOG 1 0.900 E1_COG5154
Hieranoid 1 1.000
Homologene 1 1.000 H10133
Inparanoid 1 1.050 322 1.000 Inparanoid score I2476
Isobase 1 0.950 0 Normalized mean entropy S699
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003889
OrthoInspector 1 1.000 T1085309
orthoMCL 1 0.900 OOG5_127903
Panther 1 1.100 LDO PTHR13634
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1312.710

Return to query results.
Submit another query.