DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11583 and BRIX1

Sequence 1:NP_001033989.1 Gene:CG11583 FlyBaseID:FBgn0035524 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_060791.3 Gene:BRIX1 HGNCID:24170 Length:353 Species:Homo sapiens

Alignment Length:365 Identity:167/366 (46%)
Similarity:232/366 (63%) Gaps:44/366 (12%)


  Fly     2 GRKFQNKKKKAAPQLEIVPLDENPPLPPQRSSDDV-------VPK---KEKWVNKQRVLVFSARG 56
            |...|.||.|..      .:|..||.....::::|       :|.   |.||.||:|:|:||:||
Human    11 GFAVQAKKPKRN------EIDAEPPAKRHATAEEVEEEERDRIPGPVCKGKWKNKERILIFSSRG 69

  Fly    57 ISHRDRHLMKDIKTLMPHHRPESKMERSKTLSVVNEMCEMKHCNKAMLFEGRRKRDLYMWISNTS 121
            |:.|.||||:|::.||||.:.::||:|...|.|:||:||||:|||.:.||.::|:|||||:||: 
Human    70 INFRTRHLMQDLRMLMPHSKADTKMDRKDKLFVINEVCEMKNCNKCIYFEAKKKQDLYMWLSNS- 133

  Fly   122 GSTGPSAKFLIENIHTMAELKMTGNCLRGSRPLLSFDSKFDELPHLKLLKELFVQTYSVPNHHPK 186
             ..|||||||::||||:||||||||||:|||||||||..||||||..|||||.:|.:|.|.:|||
Human   134 -PHGPSAKFLVQNIHTLAELKMTGNCLKGSRPLLSFDPAFDELPHYALLKELLIQIFSTPRYHPK 197

  Fly   187 SQPFVDHVFTFTYLDKRIWFRNFQILSEDGGLSEVGPRYVMNPVKIFDGSFTGKTIWENPDYVSP 251
            ||||||||||||.||.|||||||||:.||..|.|:|||:|:|.:|||.|||.|.|::|||.|.||
Human   198 SQPFVDHVFTFTILDNRIWFRNFQIIEEDAALVEIGPRFVLNLIKIFQGSFGGPTLYENPHYQSP 262

  Fly   252 SKQRQVLKKAAKDKYVNRVE----QKVKHEATRPIRAYDGMDNDELFEDDDPVETAKILAAIAKK 312
            :..|:|::.....||..:.:    ||::.:..:.:..:|              .||.:....|::
Human   263 NMHRRVIRSITAAKYREKQQVKDVQKLRKKEPKTLLPHD--------------PTADVFVTPAEE 313

  Fly   313 KKEEAAKQTPKSALTKKIKEKQLQAVKDVIERKKARTIKR 352
            |..|.....|:..:..|.::|::.        |:.|.:|:
Human   314 KPIEIQWVKPEPKVDLKARKKRIY--------KRQRKMKQ 345

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11583NP_001033989.1 Brix 43..290 CDD:294606 144/251 (57%)
BRIX1NP_060791.3 Brix 58..307 CDD:294606 145/265 (55%)
Prp31_C 321..>346 CDD:286825 6/34 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C148995934
eggNOG 1 0.900 E1_COG5154
Hieranoid 1 1.000
Homologene 1 1.000 H10133
Inparanoid 1 1.050 325 1.000 Inparanoid score I2458
Isobase 1 0.950 0 Normalized mean entropy S699
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003889
OrthoInspector 1 1.000 T1075204
orthoMCL 1 0.900 OOG5_127903
Panther 1 1.100 LDO PTHR13634
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R149
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.740

Return to query results.
Submit another query.