DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11583 and bxdc2

Sequence 1:NP_001033989.1 Gene:CG11583 FlyBaseID:FBgn0035524 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001166027.1 Gene:bxdc2 ZFINID:ZDB-GENE-060518-1 Length:383 Species:Danio rerio

Alignment Length:324 Identity:160/325 (49%)
Similarity:212/325 (65%) Gaps:23/325 (7%)


  Fly    27 LPPQRSSDDVVPKKEKWVNKQRVLVFSARGISHRDRHLMKDIKTLMPHHRPESKMERSKTLSVVN 91
            :||..|:.       ||.||:||||||:||||.|.||||:|:||||||.|.::||:|...|.|||
Zfish    83 VPPPVSAG-------KWTNKERVLVFSSRGISFRTRHLMQDLKTLMPHSRADTKMDRKDKLFVVN 140

  Fly    92 EMCEMKHCNKAMLFEGRRKRDLYMWISNTSGSTGPSAKFLIENIHTMAELKMTGNCLRGSRPLLS 156
            |:||:|:|||.:.||.::|:||||||||.  ..|||.|||::|:||:||||||||||:|||||||
Zfish   141 EVCEIKNCNKCIFFEAKKKQDLYMWISNV--PHGPSVKFLVQNVHTLAELKMTGNCLKGSRPLLS 203

  Fly   157 FDSKFDELPHLKLLKELFVQTYSVPNHHPKSQPFVDHVFTFTYLDKRIWFRNFQILSEDGGLSEV 221
            ||..||..|...||||||.|.:|.|.||||||||||||.:|:..|.||||||:||:.||..|.|:
Zfish   204 FDPAFDSEPQYALLKELFTQVFSTPLHHPKSQPFVDHVISFSIADHRIWFRNYQIVEEDASLVEI 268

  Fly   222 GPRYVMNPVKIFDGSFTGKTIWENPDYVSPSKQRQVLKKAAKDKYVNRVEQKVKHEATRPIRAYD 286
            |||:|:||::||.|||.|.|::|||.:.||:..|::|:.||..:...|  |.||.     :|...
Zfish   269 GPRFVLNPIRIFQGSFGGPTLYENPHFQSPNAHRRMLRLAAAARQKER--QMVKQ-----VRMEK 326

  Fly   287 GMDNDELFEDDDPVETAKILAAIAKKKKEEAAKQTPKSALTKKIKEKQLQAVKDVIERKKARTI 350
            .|:...|.:.|       :..|:.....|..|.:.......||.|::..:..|..:.:||..::
Zfish   327 RMEECVLLQPD-------LTEAVFNTPAEPKAPRPEAPGPQKKKKKRLTELKKKTLMKKKGLSV 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11583NP_001033989.1 Brix 43..290 CDD:294606 145/247 (59%)
bxdc2NP_001166027.1 Brix 92..336 CDD:294606 146/253 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C148994575
eggNOG 1 0.900 E1_COG5154
Hieranoid 1 1.000
Homologene 1 1.000 H10133
Inparanoid 1 1.050 312 1.000 Inparanoid score I2525
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003889
OrthoInspector 1 1.000 T1054453
orthoMCL 1 0.900 OOG5_127903
Panther 1 1.100 LDO PTHR13634
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R149
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.780

Return to query results.
Submit another query.