DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11583 and Brix1

Sequence 1:NP_001033989.1 Gene:CG11583 FlyBaseID:FBgn0035524 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001025086.1 Gene:Brix1 RGDID:1308508 Length:352 Species:Rattus norvegicus

Alignment Length:352 Identity:162/353 (46%)
Similarity:225/353 (64%) Gaps:27/353 (8%)


  Fly     4 KFQNKKKKAAPQLEIVPLDENPPLPPQRSSDDVVPK---KEKWVNKQRVLVFSARGISHRDRHLM 65
            |...|.:|.|.|    |..:...........|.:|.   |.||.||:|:|:||:|||:.|.||||
  Rat    17 KKPKKNRKDAGQ----PAKQADVAKEAEEEKDRIPGPVCKGKWKNKERILIFSSRGINFRTRHLM 77

  Fly    66 KDIKTLMPHHRPESKMERSKTLSVVNEMCEMKHCNKAMLFEGRRKRDLYMWISNTSGSTGPSAKF 130
            :|::.||||.:.::||:|...|.|:||:||||:|||.:.||.::|:|||||:||:  ..||||||
  Rat    78 QDLRMLMPHSKADTKMDRKDKLFVINEVCEMKNCNKCIYFEAKKKQDLYMWLSNS--PHGPSAKF 140

  Fly   131 LIENIHTMAELKMTGNCLRGSRPLLSFDSKFDELPHLKLLKELFVQTYSVPNHHPKSQPFVDHVF 195
            |::||||:||||||||||:|||||||||..||:|||..||||..:|.:|.|.:||||||||||||
  Rat   141 LVQNIHTLAELKMTGNCLKGSRPLLSFDPAFDDLPHYALLKEFLIQIFSTPRYHPKSQPFVDHVF 205

  Fly   196 TFTYLDKRIWFRNFQILSEDGGLSEVGPRYVMNPVKIFDGSFTGKTIWENPDYVSPSKQRQVLKK 260
            |||.||.|||||||||:.||..|.|:|||:|:|.:|||.|||.|.|::|||.|.||:..|:|::.
  Rat   206 TFTILDNRIWFRNFQIIEEDAALVEIGPRFVLNLIKIFQGSFGGPTLYENPHYQSPNMHRRVVRS 270

  Fly   261 AAKDKYVNRVE----QKVKHEATRPIRAYDGMDNDELFEDDDPVETAKILAAIAKKKKEEAAKQT 321
            ....||..:.:    ||.:.:..:.|..:|              .||.:....|::|..|.....
  Rat   271 ITAAKYREKQQVKDVQKSRKKEPKTILPHD--------------PTADVFVTPAEEKPIEVQWVK 321

  Fly   322 PKSALTKKIKEKQLQAVKDVIERKKAR 348
            |:..:..|.:::::......:::|.:|
  Rat   322 PEPKVDLKARKRRIYKRHRKLQQKMSR 348

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11583NP_001033989.1 Brix 43..290 CDD:294606 143/251 (57%)
Brix1NP_001025086.1 Brix 32..306 CDD:294606 149/290 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C148992563
eggNOG 1 0.900 E1_COG5154
Hieranoid 1 1.000
Homologene 1 1.000 H10133
Inparanoid 1 1.050 321 1.000 Inparanoid score I2403
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003889
OrthoInspector 1 1.000 T1088857
orthoMCL 1 0.900 OOG5_127903
Panther 1 1.100 LDO PTHR13634
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.760

Return to query results.
Submit another query.