DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11583 and brx1

Sequence 1:NP_001033989.1 Gene:CG11583 FlyBaseID:FBgn0035524 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_595107.1 Gene:brx1 PomBaseID:SPBC800.06 Length:295 Species:Schizosaccharomyces pombe

Alignment Length:308 Identity:125/309 (40%)
Similarity:182/309 (59%) Gaps:34/309 (11%)


  Fly     1 MGRKFQNKKKKAAPQLEIVPLDENPPLPP------QRSSDDVVPKKEKWVNKQRVLVFSARGISH 59
            |...::.|..:.||:.|    ||:....|      .:.|...||      .||:|||.|:||:::
pombe     1 MSTVYKLKTSERAPKNE----DEDEEYVPVQNGQGNKHSAGFVP------IKQKVLVLSSRGVTY 55

  Fly    60 RDRHLMKDIKTLMPHHRPESKMERSKTLSVVNEMCEMKHCNKAMLFEGRRKRDLYMWISNTSGST 124
            |.|||:.|:.::|||.:.:||::....|..:||:.|:.:||....||.||:.|||:.|:.  ...
pombe    56 RQRHLLNDLVSMMPHSKKDSKLDSKDRLYQLNELAELYNCNNIFFFESRRREDLYLHIAR--APN 118

  Fly   125 GPSAKFLIENIHTMAELKMTGNCLRGSRPLLSFDSKFDELPHLKLLKELFVQTYSVPNHHPKSQP 189
            ||:.||.:||:|||.||.||||.|:||||:||||..||..||||::|||..||:.:|....:|:|
pombe   119 GPTVKFHVENLHTMDELNMTGNALKGSRPILSFDKTFDTAPHLKVVKELLQQTFGIPKGARRSKP 183

  Fly   190 FVDHVFTFTYLDKRIWFRNFQIL-SEDGG-----LSEVGPRYVMNPVKIFDGSFTGKTIWENPDY 248
            |:|.|.|.|..|.:|||||::|. :||..     |.|:|||:||..:.|.:|||.|..|::|..:
pombe   184 FIDRVCTLTIADGKIWFRNYEIRENEDKSKDPVTLIEIGPRFVMTIINILEGSFGGPVIYKNDTF 248

  Fly   249 VSPSKQRQVLKKAAKDKYVNRVEQKVKHEATRPIRAY------DGMDN 290
            ||.:..|..::..|..:||||.|.|::    |.:||.      |.:||
pombe   249 VSSTMVRAAIRNQAAQRYVNRQESKLE----RQVRAQQNVIPEDPLDN 292

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11583NP_001033989.1 Brix 43..290 CDD:294606 113/259 (44%)
brx1NP_595107.1 BRX1 1..295 CDD:227483 125/309 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H10133
Inparanoid 1 1.050 225 1.000 Inparanoid score I866
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003889
OrthoInspector 1 1.000 T1125822
orthoMCL 1 0.900 OOG5_127903
Panther 1 1.100 LDO PTHR13634
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R149
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.