DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11583 and K12H4.3

Sequence 1:NP_001033989.1 Gene:CG11583 FlyBaseID:FBgn0035524 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_498756.1 Gene:K12H4.3 WormBaseID:WBGene00019678 Length:352 Species:Caenorhabditis elegans

Alignment Length:311 Identity:138/312 (44%)
Similarity:199/312 (64%) Gaps:24/312 (8%)


  Fly    29 PQRSSDDVVPKKEKWVNKQRVLVFSARGISHRDRHLMKDIKTLMPHHRPESKMERSKTLSVVNEM 93
            |::::::...:.|.|.|::||||..:||...|.|:||||||.|:||.:.:||:::.|:|:|:||:
 Worm    45 PKQATEETRKRAELWTNRERVLVLCSRGADVRTRYLMKDIKDLLPHAKGDSKLDQQKSLNVLNEI 109

  Fly    94 CEMKHCNKAMLFEGRRKRDLYMWISNTSGSTGPSAKFLIENIHTMAELKMTGNCLRGSRPLLSFD 158
            .|||:|.|.|.||.|:::|.|:|:||.  ..|||.|||:.|:|||.||||:|||||.|||:||||
 Worm   110 AEMKNCTKVMYFESRKRKDTYLWMSNV--EKGPSIKFLVHNVHTMKELKMSGNCLRASRPVLSFD 172

  Fly   159 SKFDELPHLKLLKELFVQTYSVPNHHPKSQPFVDHVFTFTYLD-KRIWFRNFQILSEDGGLSEVG 222
            ..||:.|.|||:|.:.:||...|:|||:|||||||||.|:..: .:||||||||:.|...|.|||
 Worm   173 DAFDKKPQLKLIKAVLMQTLGTPHHHPRSQPFVDHVFNFSVGEGDKIWFRNFQIVDESLQLQEVG 237

  Fly   223 PRYVMNPVKIFDGSFTGKTIWENPDYVSPSK-------------QRQVLKKAAKDKYVNRVEQKV 274
            ||:|:..|::|.|||.|..:::||:||||:.             ::|:..||:..|.....|...
 Worm   238 PRFVLEMVRLFAGSFEGAVLYDNPNYVSPNVIRREHRKGQHSYIEKQLAVKASNIKQAKVTEILA 302

  Fly   275 KHEATRPIRAYDGMDNDELFEDDDPVETAKILAAIAK----KKKEEAAKQT 321
            :.......:.:|..:|...    |....|:|.|.|.|    |||.:|:|.|
 Worm   303 EKTVDLVGKEFDTQNNAAA----DSEAAAQITAQIEKRRVRKKKSQASKYT 349

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11583NP_001033989.1 Brix 43..290 CDD:294606 123/261 (47%)
K12H4.3NP_498756.1 Brix 59..297 CDD:294606 121/240 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C148567378
eggNOG 1 0.900 E1_COG5154
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 269 1.000 Inparanoid score I1830
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003889
OrthoInspector 1 1.000 T475991
orthoMCL 1 0.900 OOG5_127903
Panther 1 1.100 LDO PTHR13634
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R149
TreeFam 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.