DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sunn and Tango5

DIOPT Version :9

Sequence 1:NP_729739.3 Gene:sunn / 326196 FlyBaseID:FBgn0052088 Length:952 Species:Drosophila melanogaster
Sequence 2:NP_001162716.1 Gene:Tango5 / 326232 FlyBaseID:FBgn0052675 Length:530 Species:Drosophila melanogaster


Alignment Length:378 Identity:81/378 - (21%)
Similarity:125/378 - (33%) Gaps:142/378 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 RQFAENSQHSHHLRCFTNELITVKYVVLQFETLKDSNS-----KPLLLATLKYLMT--------- 310
            |:..|..|    |..:...|.|.||..|:..||..:.|     :.||||||..|..         
  Fly   131 RERLERGQ----LVLWRRPLQTTKYCGLELFTLLRTWSTRLLQQRLLLATLIVLSIVFSVIYKID 191

  Fly   311 ---------LQRN-----------VASAECFTKRFHEELLHLVLRMSVSSATVASMAAKVYITLS 355
                     ::||           |.|:.......|..||:|       ...:||:....|...|
  Fly   192 GPHQLAIEFVRRNTWFFVYWLGLGVLSSVGLGTGLHTFLLYL-------GPHIASVTLAAYECNS 249

  Fly   356 QRQHQ----------EQEIEQHILETYVKIPQNPRKNITYEQF-------RNELTRYLKT----L 399
            .|..|          |:..::|:...:     :....:..|.|       ..||..|...    |
  Fly   250 LRFPQPPYPDDIICPEEPYDKHVPNIW-----SIMSKVRLEAFLWGAGTALGELPPYFMAKAARL 309

  Fly   400 IQYFP----PLQEFDFYARVLTARNVRIELSLI------------------AAQCASI---IFEM 439
            ..|.|    .|.||:    .|.|:..:..||::                  ...||||   :|::
  Fly   310 SGYDPEDAEELAEFE----ALNAKRHQKNLSMMDRGKLFMERVVERVGFFGILACASIPNPLFDL 370

  Fly   440 ------HMAEYTSLPVARDQVNELLRVW-----SRILKASSKQNGTRPLIYSIYDLIDF-DSVAE 492
                  |.               |:..|     :.|.||..|.:     |..|:.:|.| :::.|
  Fly   371 AGITCGHF---------------LVPFWTFFGATLIGKAVIKMH-----IQKIFVIIAFNETLIE 415

  Fly   493 CDADLLLNLESSCLENFLND--DTIIESEFQRLYVNISRSVGAT------GNI 537
            ...|||..|  ..|.:.|.:  .:.::::.|||:.....:.|||      ||:
  Fly   416 RAVDLLATL--PVLGHKLQEPFKSFLKNQKQRLHRQQRGAAGATTGAGDSGNL 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunnNP_729739.3 None
Tango5NP_001162716.1 SNARE_assoc <346..395 CDD:294297 10/63 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1109
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.