DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32086 and Efhc1

DIOPT Version :8

Sequence 1:NP_729720.1 Gene:CG32086 / 326195 FlyBaseID:FBgn0052086 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_082250.1 Gene:Efhc1 / 71877 MGIID:1919127 Length:648 Species:Mus musculus

Alignment Length:86 Identity:21/87 (24%)
Similarity:37/87 (43%) Gaps:14/87 (16%)


  Fly   283 SLRNQLEFH------KYALNSVLERSDTDGTGHLPLARILEIFRSFHIRLDAQKIRLALSNFRLI 341
            :|.:|:..|      |..|....:..|.|.:|::......:|..:.::.:|...|:..:   ||.
Mouse   569 ALIDQIHMHLKYNSCKENLRETFQMYDKDESGYVDRETFFKICETLNVPVDDSLIKELI---RLC 630

  Fly   342 V-DEGCATERVNYVDFFRLLS 361
            . .||    |:||.:|.|..|
Mouse   631 THGEG----RINYYNFVRAFS 647

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32086NP_729720.1 None
Efhc1NP_082250.1 Required for its localization in the mitotic spindle and interaction with alpha-tubulin. {ECO:0000250|UniProtKB:Q5JVL4} 1..45
DM10 93..198 CDD:128921
DUF1126 122..153 CDD:284078
DM10 239..359 CDD:128921
DUF1126 263..296 CDD:284078
DM10 416..520 CDD:128921
DUF1126 439..471 CDD:284078
EFh 587..647 CDD:238008 16/67 (24%)
EF-hand_7 587..646 CDD:290234 16/66 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12086
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.