DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32086 and efhc1

DIOPT Version :8

Sequence 1:NP_729720.1 Gene:CG32086 / 326195 FlyBaseID:FBgn0052086 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_957261.1 Gene:efhc1 / 393942 ZFINID:ZDB-GENE-040426-1300 Length:554 Species:Danio rerio

Alignment Length:338 Identity:68/339 (20%)
Similarity:121/339 (36%) Gaps:87/339 (26%)


  Fly    68 PSSSIRDLLTSELQKSRFMSFKEKFYEEMYFKKATLG-------GVKKTYSKPE----DVTNISQ 121
            |.::.|||..|...:::.:.||..:.:.   ::..:|       .|..::|:..    |:.|:  
Zfish    13 PGNTFRDLTKSAFHRAQTLDFKNGYAQP---RRPVVGIGQDPLLSVNISHSERNQLITDIPNL-- 72

  Fly   122 TFGSPSSQSQNECLYDVILPAKSAEQVNKEYEAFHDKYIISHNHYFPSEQVNRRYAQPFDRKSPC 186
            |:|:..|....|     .:||.:|          :||.::....|| .::|...:.:.|..:...
Zfish    73 TYGTDRSHLPLE-----FIPAHAA----------YDKKVLRFYGYF-RQEVLHSWDEHFRIRPVV 121

  Fly   187 GDIHTHGDFGLKVKRCLEEG--ENHLKVIGKAQVDFMDRNEAPLGMRNKKYTFAVPDITFGVPLR 249
            ...|...|     ..|:.|.  ||.    |..|...:.|.......|...|.:  .|:..|:.:.
Zfish   122 FYYHLEDD-----SICVTEPPVENS----GIPQGKLIKRQRLSKNPRGDLYHW--KDLNVGMDIN 175

  Fly   250 SNGDV-----------------KMLLNNIEPCYKTNRLLDAIRYLNKKRHSLRNQLEFHKYALNS 297
            ..|:|                 .::||..|.       :.:..|..::.|:  .|.....|..|.
Zfish   176 LFGEVYRITHCDPFTQDFMESQGIVLNEFES-------IPSDPYTARRAHN--QQTHITPYDHNH 231

  Fly   298 VLERSDTDGTGHLPLARILEIFRSFHIRLDAQKI----RLALSNFRLIVD--EGCATERVNY-VD 355
            .|||       .|.|.|  ::.|.|.:..|:..:    |....::.|:.|  |.|.....|. .|
Zfish   232 QLER-------FLALDR--QVLRFFALWDDSDSLYGEKRPVTLHYYLVDDSVEICEHHEANSGRD 287

  Fly   356 FFRLLSIQNSLPK 368
            .|.:|..:..:||
Zfish   288 PFPVLLRRQKIPK 300

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32086NP_729720.1 None
efhc1NP_957261.1 DM10 93..198 CDD:128921 21/117 (18%)
DUF1126 121..153 CDD:284078 9/41 (22%)
DM10 240..356 CDD:128921 15/64 (23%)
DUF1126 264..297 CDD:284078 8/33 (24%)
DM10 417..521 CDD:128921
DUF1126 440..472 CDD:284078
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12086
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.