DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32086 and CG33489

DIOPT Version :8

Sequence 1:NP_729720.1 Gene:CG32086 / 326195 FlyBaseID:FBgn0052086 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001261715.1 Gene:CG33489 / 2768971 FlyBaseID:FBgn0053489 Length:497 Species:Drosophila melanogaster

Alignment Length:511 Identity:224/512 (44%)
Similarity:302/512 (59%) Gaps:39/512 (8%)


  Fly     1 MANKGHFIDRNANIPTAGLSTSGLDGAEGVKVCLSISNP-EELAESL---VRRNYGQINKKSQKF 61
            ||||||||:||.....|||.:.| |.....|.|:.|::| ||:...|   .|||      |.|.|
  Fly     1 MANKGHFIERNGAFRAAGLPSFG-DDKISFKDCVIIAHPSEEIRHQLELECRRN------KPQPF 58

  Fly    62 -PAGSVQPSSSIRDLLTSELQKSRFMSFKEKFYEEMYFKKATLGGVKKTYSKPEDVTNISQTFGS 125
             ....:.|.|.:.:||:||.||||...|||||.|:||.|....|.::.|:|||:||||.|.|||.
  Fly    59 GKLSPILPESKMGELLSSEGQKSRVAVFKEKFLEDMYCKFGKTGQIQPTHSKPDDVTNWSHTFGR 123

  Fly   126 PSSQSQNECLYDVILPAKSAEQVNKEYEAFHDKYIISHNHYFPSEQVNRRYAQPFDRKSPCGDIH 190
            .:..:  |.||..|:|.|||:|||:||..||..:|:|:||||||||:||||.:||||.:..|.:.
  Fly   124 ANPPA--ETLYSTIMPKKSADQVNREYAEFHRGHIVSNNHYFPSEQINRRYDKPFDRLNTYGVLQ 186

  Fly   191 THGDFGLKVKRCLEEGENHLKVIGKAQVDFMDRNEAPLGMRNKKYTFAVPDITFGV-PLRSNGDV 254
            .....|..:|:||.:|:.||.|:.|..:|::.:.:||||.:.:||...|||:.||. |......:
  Fly   187 GAEHSGSTMKKCLMQGDEHLTVVSKPWMDYVQKTKAPLGKKYEKYLDKVPDVFFGYRPHTDKCTI 251

  Fly   255 KMLLNNIEPCYKTNRLLDAIRYLNKKRHSLRNQLEFHKYALNSVLERSDTDGTGHLPLARILEIF 319
            :|||.:|.||.:.|.|:.|:.|||:.|.||..:.:|:...|.:.|||.|.:.|||:||::||...
  Fly   252 RMLLEDIRPCEEDNSLVMALSYLNRLRESLHKRNDFYMMDLIASLEREDKEHTGHMPLSQILGTM 316

  Fly   320 RSFHIRLDAQKIRLALSNFRLIVDEGCATERVNYVDFFRLLSIQNSLPKTGNLTNVSD-VSCLDT 383
            ...|||:||.|||..||:|..|:||||.||||||..|.|:||:|..||..|.:.::.| :...:|
  Fly   317 YKLHIRVDAAKIRTMLSHFGKILDEGCPTERVNYDHFCRILSVQQPLPNVGCIGHIPDNMYNKET 381

  Fly   384 TYRLLCADLQ------------NKSKDNTGAISQNLEGNKTTAKDLITPDLAILRGLTHSDFTCL 436
            ||..||.|..            |:|...|..|:       |..||:|.|:|.|..||..||.|..
  Fly   382 TYTKLCKDRMADIPVSPEFNWPNRSAHRTDDIN-------THVKDVIQPELPIKVGLRPSDKTWP 439

  Fly   437 RPKAEIERIFRSLVTTDKFEAIWQSLMTKFK----DQNEMASVTQFRTEMHNKIEA 488
            |.|.:|||||.::|:.|.||.|||.:|.|.|    |..|:|||.|||..|:.::.|
  Fly   440 RSKDQIERIFDNIVSKDAFENIWQRIMAKKKTNDQDLKELASVAQFRAAMNCEMHA 495



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131257279
eggNOG 1 0.900 E1_2CJU2
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I4977
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016066at2759
OrthoFinder 1 1.000 FOG0005087
orthoMCL 1 0.900 OOG5_134044
Panther 1 1.100 P PTHR12086
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.