DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32086 and efhc-1

DIOPT Version :8

Sequence 1:NP_729720.1 Gene:CG32086 / 326195 FlyBaseID:FBgn0052086 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_509738.2 Gene:efhc-1 / 190059 WormBaseID:WBGene00013028 Length:447 Species:Caenorhabditis elegans

Alignment Length:234 Identity:45/235 (19%)
Similarity:83/235 (35%) Gaps:85/235 (36%)


  Fly   285 RNQLEFHKYALNSVLERSDTDGTGHLPLARILEIF---RSFH-------IRLDAQKIRLALSNFR 339
            |.||::             .:|...:|:..|::.:   ||||       :..:|:....|:.:|.
 Worm    32 RQQLKY-------------KNGECFVPVETIVDNYPKQRSFHHYCNAGPLLHEAEAANSAVLSFD 83

  Fly   340 LIVDEGCATERVNYVDFFRLLSIQNS---------LPKTGNL----------------------- 372
            ...:|....|.::.:..|::....|.         :..||.|                       
 Worm    84 AYAEEDGLDEEIHRIRIFKINYHLNDDTITVNEPFVDNTGYLHGRIFRRQKVPAHNRIGKPYVHW 148

  Fly   373 --TNV-SDVSCLDTTYRLLCADLQNKS--KDNTGAISQNLE-----------GNKTTA------K 415
              .|| :|::...|.||:...|...:|  :::...::::.|           |...||      :
 Worm   149 SDLNVGTDINLFQTIYRITSCDTFTRSFLEEHGTKVNEDEELPEDPWLVRRRGAPRTAPKLPDQR 213

  Fly   416 DLIT-PDLAILR--GLTH-SDFTCLRPKAEIERIFRSLV 450
            :.|. |.:.:.|  .|.| :||...|.|    |||:..|
 Worm   214 EFINRPPMLVYRCCWLDHMNDFHGCRMK----RIFKMYV 248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32086NP_729720.1 None
efhc-1NP_509738.2 DM10 76..181 CDD:128921 17/105 (16%)
DUF1126 102..134 CDD:284078 4/32 (13%)
DM10 222..326 CDD:128921 11/32 (34%)
PLPDE_III <309..>370 CDD:294187
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12086
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.