DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32081 and AT2G42005

Sequence 1:NP_729646.1 Gene:CG32081 FlyBaseID:FBgn0052081 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_850361.1 Gene:AT2G42005 AraportID:AT2G42005 Length:413 Species:Arabidopsis thaliana

Alignment Length:435 Identity:112/436 (26%)
Similarity:203/436 (47%) Gaps:71/436 (16%)


  Fly    20 SDIGAFFSLLKCVVGTGVMAIPLSFNYAGIVTGIILLVSVCFMLIHGMQMLIICMIECSRRMQIG 84
            |....|.::...:||.||:.:|.:|...|.:.|::.|.||..::.|.|.:|:      ..|.::|
plant    24 SKFKTFANVFIAIVGAGVLGLPYAFKRTGWLMGLLTLFSVAALINHCMMLLV------HIRRKLG 82

  Fly    85 YATYPVAMVYSFDQGPRFFKYISKAGRYIVDGVLAFSQFGVCVVYNVFVAATLKQL--------- 140
                 |:.:.||  |...|......||::||.::..||.|.||.|.:|:..||..|         
plant    83 -----VSNIGSF--GDLGFAACGNLGRFVVDILIILSQAGFCVGYLIFIGNTLANLSKPTKSTTL 140

  Fly   141 --VDFYWVVADLRIYIAVIALCLIPPFQ-----IRKLKYLVPFNILASILIYTGFSLMMY----Y 194
              :.....|:...:||..   |.  |||     |:.|.:|.|.:|.|.::.....::::.    .
plant   141 MSLRHLMGVSPKSLYIWG---CF--PFQLGLNSIKTLTHLAPLSIFADVVDLGAMAVVIVEDIKI 200

  Fly   195 LFVDLPPITERNILFGRIDKIPLFF---GIALFSITSVGVMLAVEA-TMAKPRHYLGWFG-ILDR 254
            ..|..|.:    :.||.:.   :||   |:|:::...||::|.:|: |..|.:     || :|..
plant   201 TVVQRPQV----VAFGGMS---VFFYGMGVAVYAFEGVGMVLPLESETKDKDK-----FGKVLAL 253

  Fly   255 AILLVIISYVTFGLMGYWRYGDETAGSISLNIPTDEVLSQVAKGFIAAAIFLTYPLAGFVIIDII 319
            ::|.:.:.|.:||::||..:||:|...|:.|:....|.|.|..| :...:|.|:||....:.:|:
plant   254 SMLFIAVMYGSFGVLGYMAFGDDTMDIITANLGAGVVSSLVQLG-LCINLFFTFPLMMNPVFEIV 317

  Fly   320 MNHFWNKNGDLPNAALKESILRACTVVLICITAIIAPNLGPLLSLVGALTISLLNLVFPALIEIC 384
            ...||        :.:....||...|:.:.:.|::.||....|||||:.....|..|.|:|..:.
plant   318 ERRFW--------SGMYCVWLRWLLVLAVTLVALLVPNFADFLSLVGSSVCCALGFVLPSLFHLM 374

  Fly   385 LYYPPEYNYGKLKW-VLVKDIFYVIVGILILVQGTVFSIKDMISE 428
            ::      ..:::| ....|:..:::|:::.|.||..|:.::..|
plant   375 VF------KDEMEWKQRALDVGILLLGVILGVSGTWSSLTEIFQE 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32081NP_729646.1 SLC5-6-like_sbd 17..422 CDD:294310 111/428 (26%)
SdaC 20..415 CDD:223884 107/421 (25%)
AT2G42005NP_850361.1 SLC5-6-like_sbd 23..408 CDD:294310 111/429 (26%)
SdaC 23..401 CDD:223884 108/422 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1577
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D464614at2759
OrthoInspector 1 1.000 T32166
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22950
Phylome 00.000 Not matched by this tool.
55.160

Return to query results.
Submit another query.