DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32081 and slc36a4

Sequence 1:NP_729646.1 Gene:CG32081 FlyBaseID:FBgn0052081 Length:471 Species:Drosophila melanogaster
Sequence 2:XP_002664741.3 Gene:slc36a4 ZFINID:ZDB-GENE-050309-239 Length:488 Species:Danio rerio

Alignment Length:461 Identity:131/462 (28%)
Similarity:228/462 (49%) Gaps:64/462 (14%)


  Fly     2 GDKGGFDPYENRNVAHPISDIGAFFSLLKCVVGTGVMAIPLSFNYAGIVTGIILLVSVCFMLIHG 66
            ||:      :::::...|:.......|||..:|||::.:||:...||||.|.:.||.:..:.:|.
Zfish    32 GDE------DSKHLPQGITFTQTLLHLLKGNIGTGLLGLPLAVKNAGIVLGPVSLVLMGVVCVHC 90

  Fly    67 MQMLIICMIECSRRMQ---IGYA-TYPVAMVYSFDQGPRFFKYISKAGRYIVDGVLAFSQFGVCV 127
            |.:|:.|..:.|.|::   :||: |...||..|..|..|...:.   ||::|:..|..:|.|.|.
Zfish    91 MHILVNCSHQLSERLKRSPLGYSETVAAAMELSSSQCLRRSAHF---GRHLVNFFLVLTQLGFCS 152

  Fly   128 VYNVFVAATLKQLVD----------------------FYWVVADLRIYIAVIALCLIPPFQIRKL 170
            ||.||:|..:||:::                      ...|..|||:|:..:...:|....||.|
Zfish   153 VYFVFLAENIKQVMEGTHMNSTAETVLLSSNSSEASVASSVAIDLRLYMVFLLPFIIVLTFIRDL 217

  Fly   171 KYLVPFNILASILIYTGFSLMMYYLFVDLPPITERNILFGRI-DKIPLFFGIALFSITSVGVMLA 234
            :.:...:.:|::.:......:..|:..||.  ..|.:.:... .|.|.|||.|:|:...:||:|.
Zfish   218 RNMAALSAIANLCMAISLIFIFSYILNDLS--DPRRLPYASTWRKFPFFFGTAIFAFEGIGVVLP 280

  Fly   235 VEATMAKPRHYLGWFGILDRAILLVIISYVTFGLMGYWRYGDETAGSISLNIPTDEVLSQVAKGF 299
            :|..|.:|:.:.   ..|:..:..:|:.|||...:||.|:.|:..|||:||:|.|...:|:.|..
Zfish   281 LENQMREPKRFP---QALNIGMGFIIVLYVTLATLGYLRFRDDIKGSITLNLPHDSWSNQLVKVL 342

  Fly   300 IAAAIFLTYPLAGFVIIDIIM-------NHFWNKNGDLPNAALKESILRACTVVLICITAIIAPN 357
            .:..:|:::.:..||..:|::       ...|.:..||.        |||..|.|.|:||::.|.
Zfish   343 YSFGVFVSFAVQFFVPAEILLPPMCERVRKSWRRVADLS--------LRALLVCLTCVTAVLIPR 399

  Fly   358 LGPLLSLVGALTISLLNLVFPALIEICLY--YPPEYNYGKLKWVLVKDIFYVIVGILILVQGTVF 420
            |..::|||||::.|.|.||||.|:|:..:  .||.      ..:|:|||....:|.:..:.||..
Zfish   400 LDLVISLVGAVSSSALALVFPPLVELIAFPSQPPP------PMLLLKDISIAALGFIGFLTGTYV 458

  Fly   421 SIKDMI 426
            :::::|
Zfish   459 TVEEII 464

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32081NP_729646.1 SLC5-6-like_sbd 17..422 CDD:294310 128/441 (29%)
SdaC 20..415 CDD:223884 125/431 (29%)
slc36a4XP_002664741.3 SLC5-6-like_sbd 42..460 CDD:294310 128/440 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C96451524
eggNOG 1 0.900 E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D284074at33208
OrthoFinder 1 1.000 FOG0000215
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22950
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.