DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32075 and AT5G12220

Sequence 1:NP_001246712.1 Gene:CG32075 FlyBaseID:FBgn0052075 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_196783.2 Gene:AT5G12220 AraportID:AT5G12220 Length:611 Species:Arabidopsis thaliana

Alignment Length:561 Identity:132/562 (23%)
Similarity:218/562 (39%) Gaps:132/562 (23%)


  Fly    19 GKQQKAKVVPVTPPPNVKQRTVVTPWRDTLEFNTTYKWLFGKSNTPATWRQALSKIRIWCLRRGS 83
            |:|.:.|    :.|...||    .||....|:::..:.||  |::|.....||.::..| ..|||
plant    16 GEQDQQK----SSPDGCKQ----VPWLSWEEWDSVRESLF--SSSPDRIASALERVATW-RSRGS 69

  Fly    84 LCPAAVLATSVLVQAHLED-----QEGSAK-------IQDTYASAFTRFYNFMSSIIQGHNMSSM 136
            | ||.|..|..|::..|:|     ::.||.       :|..|.....|..|.:....:.....|:
plant    70 L-PAPVDVTCSLIEIQLKDGFIPREKQSADALYSEHLLQMLYCMGILRLVNCVIEKTRRREDVSI 133

  Fly   137 YETAKELGLQSFIVDLRHLCAHGQELPPVEVLRNTSNHCLEWLRTYYW------LPHMETMSNLD 195
            .:.|:.:|:...::||||..:| :|||.:.|||:.::..||||::|||      :|    :....
plant   134 ADAARAIGIPRKLIDLRHEGSH-RELPALSVLRDAADEALEWLKSYYWEQQKYQIP----LKRDG 193

  Fly   196 AGKLHRKDKLKFEKAVTDLLEIYDLTLECH-------IKGAEKLKAISKLKSSGEFNKIRVYSSS 253
            ...:.|:.|.|..|..      :.|.|:.:       :|.....|.|.|:.||    .:.:|.| 
plant   194 TASIRREVKSKLRKLA------FSLQLKRNPQFDSPLVKEKCSNKRIRKIVSS----LVELYPS- 247

  Fly   254 KKAKTSKEILSAVLGDLSALVKKESSSMKDLLDIYTKCLLKMKYFLG----VGLEIDDNEDVIIA 314
                .|.|| |:||  |..|:|...||..  .|:..|.....:.||.    |.:|:.:.|..:  
plant   248 ----FSAEI-SSVL--LEFLLKALDSSKS--TDLQNKAGQDFRVFLDEWKPVIMELSNREPEL-- 301

  Fly   315 ATQGLFRLLAVQGYIEKVFLALVQLSENQNESEQRRLGASYWAKKMLETFGMLFRMKRMYKAELD 379
                |..||       |..|.::|.:|.:....::.:......:::...|..|..:....| ...
plant   302 ----LLTLL-------KEVLDMIQNNERRRHETEKPVEEVSQVEQVPFLFAWLVSLLNGSK-HFQ 354

  Fly   380 LNDKLK---PADFATLNTDKISKTMRSLLVHSNADLSVTLIFGDNPKKSRSLIFDRDFIMQRVDA 441
            .|..|:   |:.|       :.:.:|..||.......:.|       ||..|:  .:.:..||..
plant   355 RNSSLEVKPPSIF-------LMELIRRCLVLGALGYELVL-------KSAFLL--AEIVGGRVLK 403

  Fly   442 FSNYSAPIL---KGLLPLADPPYTKTQIEDLTKLCDAQLEEFYEEEAMEEDSSSEESNNL----D 499
            ......|::   ..::||..   :.|.:...|.|.                   |:..||    .
plant   404 EKLIKLPLMHKSSAIVPLKQ---SSTLVTASTTLL-------------------EQEKNLGNAGK 446

  Fly   500 RLERFLEQAAQSKEHTSD--WGVWKLDKHTDWPKCALGVLP 538
            |||....|.::.|...:|  ...|:  |...|..|.:|:||
plant   447 RLEFVKLQLSKKKGIDTDKTGNRWR--KAKTWSPCPIGMLP 485

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32075NP_001246712.1 Las1 42..186 CDD:281960 48/162 (30%)
AT5G12220NP_196783.2 Las1 31..182 CDD:281960 48/156 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1070386at2759
OrthoInspector 1 1.000 T193014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR15002
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.