DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adi1 and ADI1

DIOPT Version :8

Sequence 1:NP_001097577.1 Gene:Adi1 / 326189 FlyBaseID:FBgn0052068 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_013722.1 Gene:ADI1 / 855021 SGDID:S000004611 Length:179 Species:Saccharomyces cerevisiae

Alignment Length:181 Identity:80/182 (44%)
Similarity:103/182 (57%) Gaps:16/182 (9%)


  Fly     1 MVQVWYMDTE-ETDQRLEHHRNPPAYLELDDLYQKTGVEYFKINADEYQSDNTLTELRAKRGYTY 64
            ||:|:..|.: ::|.|..|  |....|.||:| .|.||.| |..|:|.:    :.|:..:|.|..
Yeast     1 MVKVYIHDNKVDSDYRAPH--NSGTELSLDEL-AKLGVIY-KYCANEEE----VNEIARQREYKN 57

  Fly    65 DDEITCSE---KCLPDYANKLKAFFTEHLHTDEEIRLILEGSGYFDVRD--NEDNWLRIKVVKGD 124
            .|.:...|   |...::..||..|:.||||.|||||..|||:|||||||  ..:||:|..|..||
Yeast    58 RDVVNICEGSFKSEAEFNEKLATFYQEHLHEDEEIRYCLEGAGYFDVRDASTPENWIRCLVESGD 122

  Fly   125 LIIIPAGIYHRFTLDTNNFIRTRRYFVGEPVWAPHNR--PADEMDCRKSYI 173
            |:|:|.||||||||.|:|.|:..|.|..||.|...||  .||.:..||.||
Yeast   123 LLILPPGIYHRFTLTTSNHIKALRLFKDEPKWQAINRSNQADSLPVRKDYI 173

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Adi1NP_001097577.1 cupin_like 3..158 CDD:304367 70/161 (43%)
ADI1NP_013722.1 Adi1 1..179 CDD:224704 80/182 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C208173090
eggNOG 1 0.900 E1_COG1791
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I1279
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002451
OrthoInspector 1 1.000 T1135842
orthoMCL 1 0.900 OOG5_128685
Panther 1 1.100 LDO PTHR23418
Phylome 1 0.910 0.890 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R760
TreeFam 1 0.960
1110.780

Return to query results.
Submit another query.