DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adi1 and ADI1

DIOPT Version :8

Sequence 1:NP_001097577.1 Gene:Adi1 / 326189 FlyBaseID:FBgn0052068 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_060739.2 Gene:ADI1 / 55256 HGNCID:30576 Length:179 Species:Homo sapiens

Alignment Length:175 Identity:90/176 (51%)
Similarity:123/176 (70%) Gaps:3/176 (2%)


  Fly     1 MVQVWYMDTEETDQRLEHHRNPPAYLELDDLYQKTGVEYFKINADEYQSDNTLTELRAKRGYTYD 65
            |||.||||....|.|..|..:|...:.|:.| ::.||.|:|::||:|::|..|.::|.:|.|::.
Human     1 MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQL-RRLGVLYWKLDADKYENDPELEKIRRERNYSWM 64

  Fly    66 DEIT-CSEKCLPDYANKLKAFFTEHLHTDEEIRLILEGSGYFDVRDNEDNWLRIKVVKGDLIIIP 129
            |.|| |.:| ||:|..|:|.|:.||||.|:|||.||:|||||||||.||.|:||.:.|||::.:|
Human    65 DIITICKDK-LPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLP 128

  Fly   130 AGIYHRFTLDTNNFIRTRRYFVGEPVWAPHNRPADEMDCRKSYIK 174
            ||||||||:|..|:.:..|.|||||||..:|||||..:.|..|:|
Human   129 AGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVK 173

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Adi1NP_001097577.1 cupin_like 3..158 CDD:304367 80/156 (51%)
ADI1NP_060739.2 ARD 3..157 CDD:281122 80/156 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C208157853
eggNOG 1 0.900 E1_COG1791
Hieranoid 1 1.000
Homologene 1 1.000 H75081
Inparanoid 1 1.050 191 1.000 Inparanoid score I3807
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1166094at2759
OrthoFinder 1 1.000 FOG0002451
OrthoInspector 1 1.000 T1072896
orthoMCL 1 0.900 OOG5_128685
Panther 1 1.100 LDO PTHR23418
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R760
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.