DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adi1 and K07E1.1

DIOPT Version :8

Sequence 1:NP_001097577.1 Gene:Adi1 / 326189 FlyBaseID:FBgn0052068 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_494804.2 Gene:K07E1.1 / 24104726 WormBaseID:WBGene00019489 Length:158 Species:Caenorhabditis elegans

Alignment Length:155 Identity:54/156 (35%)
Similarity:86/156 (55%) Gaps:2/156 (1%)


  Fly     1 MVQVWYMDTEET-DQRLEHHRNPPAYLELDDLYQKTGVEYFKINA-DEYQSDNTLTELRAKRGYT 63
            |||:|.|:.... |.||.||..||..:..|:|.::||..|:|::. |:......||.|:.:..:.
 Worm     1 MVQIWQMEPYPCGDPRLPHHLFPPKKITPDELSKRTGTLYWKLDTLDQVALAKRLTTLKLEHSFK 65

  Fly    64 YDDEITCSEKCLPDYANKLKAFFTEHLHTDEEIRLILEGSGYFDVRDNEDNWLRIKVVKGDLIII 128
            .:|..|...:...::.:|::..|.|.....|:.|:|:||:.|:||.|....|:||....||||:|
 Worm    66 KEDIFTLDAETTANFDDKIEELFEESSVPFEQARMIIEGTAYYDVEDKNGQWVRIFCEYGDLILI 130

  Fly   129 PAGIYHRFTLDTNNFIRTRRYFVGE 153
            ||....|||...:||::.||::..|
 Worm   131 PANTCFRFTTTPHNFVKMRRFYKDE 155

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Adi1NP_001097577.1 cupin_like 3..158 CDD:304367 52/154 (34%)
K07E1.1NP_494804.2 ARD 3..156 CDD:281122 52/154 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C208155880
eggNOG 1 0.900 E1_COG1791
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1166094at2759
OrthoFinder 1 1.000 FOG0002451
OrthoInspector 1 1.000 T375098
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23418
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
98.820

Return to query results.
Submit another query.