DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: scramb1 and Plscr2

Sequence 1:NP_648389.3 Gene:scramb1 FlyBaseID:FBgn0052056 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_011240977.1 Gene:Plscr2 MGIID:1270860 Length:358 Species:Mus musculus

Alignment Length:367 Identity:166/368 (45%)
Similarity:198/368 (54%) Gaps:65/368 (18%)


  Fly    48 HPQPPPPTNYGF-MPGPQ-----PAGYAPVPQMPPYG-EAPPYGAGQPPYMGGPGGQPPYAGGPG 105
            ||.|    :.|. |..|:     |||||  ||.||.. :.||...|:|.:.  ...|.|.:|.||
Mouse    43 HPSP----HTGLQMEAPRSGTYLPAGYA--PQYPPAAVQGPPEHTGRPTFQ--TNYQVPQSGYPG 99

  Fly   106 GQPPYVGGPGGQPHYGGGAPPPQAFGGYPPGPAGPGGPPNAFGGYPPGQPQQPIV---TQPGMGP 167
            .|..|.....|...|.....|.                          |..|.||   ||     
Mouse   100 PQASYTVSTSGHEGYAATRLPI--------------------------QNNQTIVLANTQ----- 133

  Fly   168 GMGPGMAPQGGPAGDWMSIPTGIPNCPRGLEYLTTIDQLLVKQKVELLEAFTGFETNNKFTIKNA 232
                           ||..|..|.|||.|||||..|||||:.|:|||||..|||||||||.|||:
Mouse   134 ---------------WMPAPPPILNCPPGLEYLNQIDQLLIHQQVELLEVLTGFETNNKFEIKNS 183

  Fly   233 LGQKVYFAAEDNDCCTRNCCGPARPFDMRVFDNFQQEVIHMHRPLACSSCLFPCCLQSIEVSAPP 297
            |||.||.|.||.||||||||..:|||.:|:.|:..|||:.:.|||.||||.||||||.||:.|||
Mouse   184 LGQMVYVAVEDTDCCTRNCCEASRPFTLRILDHLGQEVMTLERPLKCSSCCFPCCLQEIEIQAPP 248

  Fly   298 GNVIGTIEQEWSICSPSFRILNHVGDTVMRIEGPFCTFSLCGDVEFNVVSLTG-EKIGKISKQWS 361
            |..||.:.|.|..|.|...:.|...:.|:::.||....:.|.|::|.:.||.. .:||||:||||
Mouse   249 GVPIGYVTQTWHPCLPKLTLQNDKRENVLKVVGPCVACTCCSDIDFEIKSLDEVTRIGKITKQWS 313

  Fly   362 GLAREIFTDADFFGINFPLDLDVRMKAVLLGATFLIDAMFFE 403
            |..:|.|||:|.|||.|||||:|:||||.|||.||||.||||
Mouse   314 GCVKEAFTDSDNFGIQFPLDLEVKMKAVTLGACFLIDYMFFE 355

Known Domains:


GeneSequenceDomainRegion External IDIdentity
scramb1NP_648389.3 Sox_C_TAD <61..>129 CDD:288887 24/74 (32%)
Scramblase 184..404 CDD:252175 130/222 (59%)
Plscr2XP_011240977.1 WWbp <61..112 CDD:304964 21/55 (38%)
Scramblase 135..355 CDD:252175 129/220 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C255374199
eggNOG 1 0.900 E1_KOG0621
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 326 1.000 Inparanoid score I2452
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1015148at2759
OrthoFinder 1 1.000 FOG0000147
OrthoInspector 1 1.000 T131044
orthoMCL 1 0.900 OOG5_128653
Panther 1 1.100 O PTHR23248
Phylome 1 0.910 0.861 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.