DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: scramb1 and Plscr5

Sequence 1:NP_648389.3 Gene:scramb1 FlyBaseID:FBgn0052056 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001182622.1 Gene:Plscr5 MGIID:3779462 Length:274 Species:Mus musculus

Alignment Length:280 Identity:117/281 (42%)
Similarity:161/281 (57%) Gaps:25/281 (9%)


  Fly   127 PQAFGGYPPGPAGPGGPPNAFGGYPPGQP-QQPIVTQPGMGPGMGPGMAPQGGPAGDWMSIPTGI 190
            |::..|:.|....|..........|..|. |||.|:||.                   ..:||. 
Mouse    11 PRSLPGFLPRATNPDQNSQEASSNPRKQARQQPGVSQPS-------------------SFLPTA- 55

  Fly   191 PNCPRGLEYLTTIDQLLVKQKVELLEAFTGFETNNKFTIKNALGQKVYFAAEDNDCCTRNCCGPA 255
             ..|.|||||:.:|.:::.|:||||....|.||:||:.|||:|||::|||.|::.|..||.|...
Mouse    56 -TLPPGLEYLSQLDLIIIHQQVELLGMILGTETSNKYEIKNSLGQRIYFAVEESICFNRNVCSTL 119

  Fly   256 RPFDMRVFDNFQQEVIHMHRPLACSSCLFPCCLQSIEVSAPPGNVIGTIEQEWSICSPSFRILNH 320
            |...:|:.||..:|||.::|||.|:||..||.||.:|:.||||.::|.:.|:|....|.|.|.|.
Mouse   120 RACTLRITDNSGREVITVNRPLRCNSCWCPCYLQELEIQAPPGTIVGYVAQKWGPFQPKFTIQNA 184

  Fly   321 VGDTVMRIEGPFCTFSLCGDVEFNVVSLTGEK--IGKISKQWSGLAREIFTDADFFGINFPLDLD 383
            ..:.:::|.||..|....|||:|.|.:: .||  ||||||.|||...::||:||.|||:.|.|||
Mouse   185 NKEDILKIIGPCTTCGCFGDVDFEVKTV-DEKVTIGKISKYWSGFVNDVFTNADNFGIHVPADLD 248

  Fly   384 VRMKAVLLGATFLIDAMFFE 403
            |.:||.::||.||.|.||||
Mouse   249 VTLKAAMIGACFLFDFMFFE 268

Known Domains:


GeneSequenceDomainRegion External IDIdentity
scramb1NP_648389.3 Sox_C_TAD <61..>129 CDD:288887 1/2 (50%)
Scramblase 184..404 CDD:252175 105/223 (47%)
Plscr5NP_001182622.1 Scramblase 48..268 CDD:252175 105/242 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0621
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1015148at2759
OrthoFinder 1 1.000 FOG0000147
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23248
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1891
TreeFam 1 0.960
77.000

Return to query results.
Submit another query.