DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32052 and smpd1

Sequence 1:NP_001303410.1 Gene:CG32052 FlyBaseID:FBgn0044328 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001313465.1 Gene:smpd1 ZFINID:ZDB-GENE-110411-222 Length:591 Species:Danio rerio

Alignment Length:499 Identity:141/500 (28%)
Similarity:213/500 (43%) Gaps:111/500 (22%)


  Fly    19 PGA-QARIGYFWHISDLHLDTLYSTQGDIYRSCWELARSVSGSNANSAAS---EPPGPFGHYN-C 78
            ||: ::||.:   ::|:|.|..| |:|    |..|..:.:...|.:..||   ...|.:|.|: |
Zfish   161 PGSPRSRILF---LTDIHWDAEY-TEG----SLAECNKPLCCRNDSGRASWRHAGAGYWGTYSKC 217

  Fly    79 DSPWRLIESAVKTMKAKQGDNVEFVLWTGDALSHSAQPLSEQKQHEILRNITEL----LGRSFSS 139
            |.|.|.:|:.::.: ||.|. .::|.||||..:|:....:..:|...|..|:.|    |||:.: 
Zfish   218 DLPLRTVENLLENV-AKSGP-WDWVYWTGDIPAHNVWSQTRNQQLNELVTISRLIHKHLGRNVT- 279

  Fly   140 QFIFPVLG-HED------------GSGS----YRRLGELWRHWLPSEALVTFDQGGYYSIEQTKS 187
              ::|.:| ||.            |:.|    |..:.:.|..|||.|||.|..:||:||:| .:.
Zfish   280 --VYPAVGNHESTPVNSFPPPFVHGNHSSRWLYETMAKEWAPWLPEEALETIRRGGFYSVE-VEP 341

  Fly   188 RLRIVALNTNFMRLDPDPDPRASLSLRWPAEYFAEPKASVSSISAEDELLAEQQWLWLEEVLTKS 252
            .||:|:||.||          .|....|         ..|:|....|:|      .||.::|.:|
Zfish   342 GLRLVSLNMNF----------CSRENYW---------LMVNSTDPADQL------QWLIQILQES 381

  Fly   253 KEKQETVYIVGHMPPGVDERHLGTQHNQLTFTERN-NQRYLDMVRRFAPVIQGQFFGHLHSDTFR 316
            :.|.|.|:|:||:|||              |...: :..|..:|.|:...|.||||||.|:|.|:
Zfish   382 ENKGEKVHIIGHIPPG--------------FCLSSWSWNYYHIVNRYESTITGQFFGHTHTDEFQ 432

  Fly   317 LIYDAK--GNPISWLMIAPSIVPRKAGIGSSNNPALRLYKFD----TGSGQVLDYTQFWLDLPLA 375
            :.||.:  ..|:|...||||:.     ...:.||..|:|..|    ..|..|||:..|.|:|.||
Zfish   433 MFYDEETLTRPLSVAFIAPSVT-----TFVNLNPGYRVYYVDGNYPDSSRMVLDHETFILNLTLA 492

  Fly   376 NRA-----NEPTWQPEYNLTHYYALPEISAVALHNFAERFTGTD----LSWFTRYHRANAVRYHS 431
            |..     ..|:|...|..:..|.|..:....:....:.....|    ..|:. :|:.     |.
Zfish   493 NNRPLKPDPRPSWTLLYRASEAYGLSTLFPSDMEALIKHMVNDDRIFQQFWYL-FHKG-----HV 551

  Fly   432 GSACPGLCMLNHYCAITRLDYDEFRICLEKEQLALQGRAPAALM 475
            ...|...|..:..|.:....||....|     ..|.|..|...|
Zfish   552 SKPCKDTCKTSIICFLHSGRYDLLTQC-----SPLHGDTPKKSM 590

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32052NP_001303410.1 MPP_ASMase 28..351 CDD:277321 105/351 (30%)
smpd1NP_001313465.1 SapB 54..127 CDD:214797
MPP_ASMase 168..464 CDD:277321 106/354 (30%)
Metallophos 221..429 CDD:278574 76/253 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3770
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1142100at2759
OrthoFinder 1 1.000 FOG0000452
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R975
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.