DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32052 and Xkr8

Sequence 1:NP_001303410.1 Gene:CG32052 FlyBaseID:FBgn0044328 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001012099.1 Gene:Xkr8 RGDID:1305649 Length:399 Species:Rattus norvegicus

Alignment Length:310 Identity:58/311 (19%)
Similarity:87/311 (28%) Gaps:132/311 (42%)


  Fly     1 MLLAPISWLGFLLAYSGLPGAQARI-----GYFWHISD---LH--------LDTLYSTQ-GDIYR 48
            :|:....|...::...|    ||.:     .:.|..:|   ||        |..|:..| |.:||
  Rat    38 VLVGRYLWAALVVVLLG----QASVLLQLFSWLWLTADPTELHQLQPSRRFLALLHLLQLGYLYR 98

  Fly    49 SCWELARSVSGSNANSAASEPPGPFGHYNCD-----------SPWRLIESAVKTMK--------A 94
            ....:.:.:|     ....|.|.     .||           |..||.||.::...        .
  Rat    99 CLHGMRQGLS-----MCCQEVPS-----ECDLAYADFLSLDISMLRLFESFLEATPQLTLVLAIV 153

  Fly    95 KQGDNVEFVLWTGDALSHSAQPLSEQKQHEILRNITELLGRSFSSQFIFPVLGHEDGSGSYRRLG 159
            .|..|.|:..|.|                             .||.|                ||
  Rat   154 LQSGNAEYYQWFG-----------------------------ISSSF----------------LG 173

  Fly   160 ELW---------RHWLPSEALVTFDQGGYYSIEQTKSRLRIVALNTNFMRLDPDPDPRASLSLRW 215
            ..|         |..|||:..:.:.....|.:             .|.:.|.|.....|:.|:.:
  Rat   174 ISWALLDYHRSLRTCLPSKPRLGWCSSAVYFL-------------WNLLLLGPRICAIATFSVVF 225

  Fly   216 P---AEYFAEPKASVSSISAEDELLAEQQWLWLEEVLTKSKEKQETVYIV 262
            |   |.:|         :|....||   .|:||::.........|.:|.|
  Rat   226 PYCLALHF---------LSLWLVLL---YWVWLQDTKFMPNSNGEWLYRV 263

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32052NP_001303410.1 MPP_ASMase 28..351 CDD:277321 53/279 (19%)
Xkr8NP_001012099.1 XK-related 17..343 CDD:286853 58/311 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127556
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.