DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32052 and Smpdl3a

Sequence 1:NP_001303410.1 Gene:CG32052 FlyBaseID:FBgn0044328 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001005539.1 Gene:Smpdl3a RGDID:1359277 Length:445 Species:Rattus norvegicus

Alignment Length:473 Identity:149/474 (31%)
Similarity:234/474 (49%) Gaps:59/474 (12%)


  Fly     6 ISWL---GFLLAYSGLPGAQARIGYFWHISDLHLDTLYSTQGDIYRSCWELARSVSGSNANSAAS 67
            ::||   |..:..:...||.| :|.|||::|||||..|....|..:.|    .|..|:|.::   
  Rat    13 VAWLCDPGLGVPLAPAYGAPA-VGQFWHVTDLHLDPTYHITDDHTKVC----ASSKGANVSN--- 69

  Fly    68 EPPGPFGHYNCDSPWRLIESAVKTMKAKQGDNVEFVLWTGDALSH-SAQPLSEQKQHEILRNITE 131
              |||||...||||::||.||...:| ..|....|::||||:..| ..:.||.....|::.|:|.
  Rat    70 --PGPFGDVLCDSPYQLILSAFDFIK-NSGQEASFMIWTGDSPPHVPVRELSTGSVIEVITNMTV 131

  Fly   132 LLGRSFSSQFIFPVLGHED----------GSGSYRRLGELWRHWLPSEALVTFDQGGYYSIEQTK 186
            .:...|.:..:||.||:.|          .|..|..:.:||:.||..||:.|..:||:|| ::..
  Rat   132 TVQNLFPNLQVFPALGNHDYWPQDQLPIATSKVYSAVSDLWKPWLDEEAISTLRKGGFYS-QKVA 195

  Fly   187 SR--LRIVALNTNFMRLDPDPDPRASLSLRWPAEYFAEPKASVSSISAEDELLAEQQWLWLEEVL 249
            |.  |||::||||.                    |:.   .::.:::..|   ...|:.|||..|
  Rat   196 SNPDLRIISLNTNL--------------------YYG---PNIMTLNKTD---PANQFEWLENTL 234

  Fly   250 TKSKEKQETVYIVGHMPPGVDERHLGTQHNQLTFTERNNQRYLDMVRRFAPVIQGQFFGHLHSDT 314
            ..|...:|.||::.|:|.|    :|..........:..|::.:|:.||::.||.|||:||.|.|:
  Rat   235 NSSLRNKEKVYVIAHVPVG----YLPYATKTPAMRQYYNEKLVDIFRRYSSVIAGQFYGHTHRDS 295

  Fly   315 FRLIYDAKGNPISWLMIAPSIVPRKAGI-GSSNNPALRLYKFDTGSGQVLDYTQFWLDLPLANRA 378
            ..::.|..||||:.:.:||::.|.|..: ..:|||.:||:::..|...:||..|::|:|..||..
  Rat   296 LMVLSDKNGNPINSVFVAPAVTPVKGVLEKETNNPGVRLFQYKPGDYTLLDMLQYYLNLTEANLK 360

  Fly   379 NEPTWQPEYNLTHYYALPEISAVALHNFAERFTGTDLSWFTRYHRANAVRYHSGSACPGLCMLNH 443
            .|..|..||.||..|.:.::...:||..|::....|...|.:|:....|.|.|.:.|...|....
  Rat   361 GESNWTLEYTLTQAYGVADLQPKSLHGLAQQLATIDSKQFLKYYHYFFVSYDSSAPCDQRCKTLQ 425

  Fly   444 YCAITRLDYDEFRICLEK 461
            .|||..||...:..||::
  Rat   426 ICAIMNLDLVSYEDCLKR 443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32052NP_001303410.1 MPP_ASMase 28..351 CDD:277321 107/337 (32%)
Smpdl3aNP_001005539.1 MPP_ASMase 37..333 CDD:277321 107/337 (32%)
Metallophos 73..294 CDD:278574 77/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C34146291
eggNOG 1 0.900 E1_KOG3770
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I3269
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1142100at2759
OrthoFinder 1 1.000 FOG0000452
OrthoInspector 1 1.000 T618286
orthoMCL 1 0.900 OOG5_127556
Panther 1 1.100 O PTHR10340
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
1110.760

Return to query results.
Submit another query.