DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32052 and ZK856.5

Sequence 1:NP_001303410.1 Gene:CG32052 FlyBaseID:FBgn0044328 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_505620.4 Gene:ZK856.5 WormBaseID:WBGene00014106 Length:459 Species:Caenorhabditis elegans

Alignment Length:459 Identity:127/460 (28%)
Similarity:203/460 (44%) Gaps:77/460 (17%)


  Fly    30 HISDLHLDTLYSTQGDIYRSCWELARSVSGSNANSAASEPPGPFGHYNCDSPWRLIESAVKTMKA 94
            |::|.|||..||..||....|.:     .|:..|:..    |.:|.|.||:|..||:.|:.. .|
 Worm    25 HLADFHLDVQYSINGDNKHMCHD-----DGTERNTTL----GEYGDYMCDAPKPLIQLAIDE-SA 79

  Fly    95 KQGDNVEFVLWTGDALSHSAQPLSEQKQHEILRNITELLGRSFSSQFIFPVLGHED--------- 150
            :...|.:.::||||.::| ......:...:.:...|.||...|.:|.|.|..|:.|         
 Worm    80 RIFPNPDLIIWTGDNVAH-IDGYGWEIVLDAVNQTTSLLFSRFPNQTILPTFGNHDYAPSNGFES 143

  Fly   151 GSGSYRRLGELWRHWLPSEALVTFDQGGYYSIEQTKSRLR---IVALNTNFMRLDPDPDPRASLS 212
            .|..|.:..|||:..|..|...||.:||||     |.|||   .|.||||.              
 Worm   144 ESSLYTKTWELWKGKLGDENKATFLKGGYY-----KYRLRNATAVVLNTNL-------------- 189

  Fly   213 LRWPAEYFAEPKASVSSISAEDELLAEQQWLWLEEVLTK--------SKEKQETVYIVGHMPPGV 269
                  |:...||.|:..:..|   ...|:.:||:.|:.        |:.....|:||.|:.|||
 Worm   190 ------YYNANKAYVNFTNKVD---PADQFAFLEKELSNAEKCPNRISENCTSIVHIVAHIGPGV 245

  Fly   270 DERHLGTQHNQLTFTERNNQRYLDMVRRFAPVIQGQFFGHLHSDTFRLIYDAKGNPISWLMIAPS 334
            .|:    ..|...|.:..|:|:||:..|:|..|....|||.|:|||.||.|:|.|.:...::||:
 Worm   246 FEK----TPNFTWFRDEYNERFLDLTVRYANSIGWMIFGHHHTDTFHLIKDSKENNVQLALMAPA 306

  Fly   335 IVPRKAGI--GSSNNPALRLYKFDTGSGQVLDYTQFWLDLPLANRANEPTWQPEYNLTHYYALP- 396
            :.|..:.:  ..:|||..|:|:.|..| ::.|.:.::::|...|:.....:..||:....|.:. 
 Worm   307 VTPWFSDLPGAGANNPTFRVYETDAYS-KIQDISTYFINLDDLNKNKSTPFVFEYSFKDAYGITG 370

  Fly   397 EISAVALHNFAERFTGTDLSWFTRYHRANAVRYHSGSACP----GLCMLNHYCAITRLDYDEFRI 457
            :|:...:....::....| :.|.:|     :.|::....|    |:......|::...||..:..
 Worm   371 DINPTTMSALLDKMKNND-TLFKKY-----IDYNTAFWNPQMPLGVYRGAQLCSMEYSDYPRYYS 429

  Fly   458 CLEK 461
            ||.|
 Worm   430 CLSK 433

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32052NP_001303410.1 MPP_ASMase 28..351 CDD:277321 104/343 (30%)
ZK856.5NP_505620.4 MPP_ASMase 23..325 CDD:277321 104/343 (30%)
Metallophos 73..285 CDD:278574 70/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C33340363
eggNOG 1 0.900 E1_KOG3770
Hieranoid 1 1.000
Homologene 1 1.000 H8708
Inparanoid 1 1.050 144 1.000 Inparanoid score I3009
Isobase 1 0.950 0 Normalized mean entropy S3862
OMA 1 1.010
OrthoDB 1 1.010 D1116351at2759
OrthoFinder 1 1.000 FOG0000452
OrthoInspector 1 1.000 T477335
orthoMCL 1 0.900 OOG5_127556
Panther 1 1.100 LDO PTHR10340
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R975
TreeFam 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.