DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and DA1

DIOPT Version :10

Sequence 1:NP_610098.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_173361.1 Gene:DA1 / 838510 AraportID:AT1G19270 Length:532 Species:Arabidopsis thaliana


Alignment Length:166 Identity:40/166 - (24%)
Similarity:56/166 - (33%) Gaps:47/166 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITK-RMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGC 69
            :|..|...|.. |.:..|...||||.|.|:.|.:.|.:..|:.....|....|:.|||...|..|
plant   171 ICAGCNMEIGHGRFLNCLNSLWHPECFRCYGCSQPISEYEFSTSGNYPFHKACYRERYHPKCDVC 235

  Fly    70 K---------------KPILEKTICAMGESWHEDC-FCCGGACKKPLANQTFYE--RDGKPYCKK 116
            .               .|...:..|...|  |:.. .||  :|::.....|.|.  .||:..   
plant   236 SHFIPTNHAGLIEYRAHPFWVQKYCPSHE--HDATPRCC--SCERMEPRNTRYVELNDGRKL--- 293

  Fly   117 DYEDLFAARCAKCEKPITDSAVLAMNVKWHRDCFRC 152
                     |.:|    .||||:        |..:|
plant   294 ---------CLEC----LDSAVM--------DTMQC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_610098.1 LIM 126..176 CDD:259829 8/27 (30%)
LIM 7..58 CDD:413332 15/51 (29%)
LIM 66..118 CDD:413332 13/69 (19%)
DA1NP_173361.1 PTZ00482 29..>132 CDD:240433
LIM_DA1 172..224 CDD:188782 15/51 (29%)
DA1-like 321..527 CDD:463530
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.