DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and PLIM2c

DIOPT Version :10

Sequence 1:NP_610098.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_191682.2 Gene:PLIM2c / 825295 AraportID:AT3G61230 Length:213 Species:Arabidopsis thaliana


Alignment Length:156 Identity:37/156 - (23%)
Similarity:58/156 - (37%) Gaps:43/156 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAI-TKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYT----- 65
            |..|.:.: ...::|..|..:|...|.|.||:..::...::...|...|...|.:.:..:     
plant    11 CKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVICNYSSMDGVLYCKTHFEQLFKESGNFSK 75

  Fly    66 -------------------------------CAGCKKPI--LEKTICAMGESWHEDCF-CCGGAC 96
                                           ||.|||.:  ||| :...|||:|:.|| |....|
plant    76 NFQTAGKTEKSNDATKAPNRLSSFFSGTQDKCAACKKTVYPLEK-MTMEGESYHKTCFRCAHSGC 139

  Fly    97 KKPLANQTFYERDGKPYCKKDYEDLF 122
              ||.:.::...||..|||..:..||
plant   140 --PLTHSSYAALDGVLYCKVHFSQLF 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_610098.1 LIM 126..176 CDD:259829
LIM 7..58 CDD:413332 11/51 (22%)
LIM 66..118 CDD:413332 23/54 (43%)
PLIM2cNP_191682.2 LIM1_SF3 7..69 CDD:188824 12/57 (21%)
LIM 107..167 CDD:413332 25/60 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.