DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and WLIM2a

DIOPT Version :10

Sequence 1:NP_610098.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_181519.1 Gene:WLIM2a / 818577 AraportID:AT2G39900 Length:200 Species:Arabidopsis thaliana


Alignment Length:159 Identity:31/159 - (19%)
Similarity:58/159 - (36%) Gaps:46/159 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAI-TKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYT----- 65
            |..|::.: ...:::|.|.::|...|.|.||..::..:.::...|...|...|.:.:..:     
plant    10 CRACEKTVYPVELLSADGISYHKACFKCSHCKSRLQLSNYSSMEGVVYCRPHFEQLFKESGSFSK 74

  Fly    66 ----------------------------------CAGCKKPI--LEKTICAMGESWHEDCF-CCG 93
                                              ||.|.|.:  :|| :....:.:|:.|| |..
plant    75 NFQSPAKPLTDKPTPELNRTPSRLAGMFSGTQDKCATCTKTVYPIEK-VTVESQCYHKSCFKCSH 138

  Fly    94 GACKKPLANQTFYERDGKPYCKKDYEDLF 122
            |.|  |::...:...:|..|||..:..||
plant   139 GGC--PISPSNYAALEGILYCKHHFAQLF 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_610098.1 LIM 126..176 CDD:259829
LIM 7..58 CDD:413332 11/51 (22%)
LIM 66..118 CDD:413332 17/54 (31%)
WLIM2aNP_181519.1 LIM1_SF3 6..68 CDD:188824 12/57 (21%)
LIM2_SF3 109..169 CDD:188825 19/60 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.