DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and Zasp52

DIOPT Version :10

Sequence 1:NP_610098.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027420.2 Gene:Zasp52 / 36740 FlyBaseID:FBgn0265991 Length:2194 Species:Drosophila melanogaster


Alignment Length:172 Identity:59/172 - (34%)
Similarity:88/172 - (51%) Gaps:5/172 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITALGKTWHPEHFLC--HHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAG 68
            :|:.|...|....|||||:.|.|:||:|  .:|...:.|..|..:.|:..|..||.:....||:.
  Fly  2019 LCNSCNVQIRGPFITALGRIWCPDHFICVNGNCRRPLQDIGFVEEKGDLYCEYCFEKYLAPTCSK 2083

  Fly    69 CKKPILEKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPI 133
            |...|....:.|:|:.:|.:||.| |.|.|...|:.|:..||..||:.|:.:||..:|..|..|:
  Fly  2084 CAGKIKGDCLNAIGKHFHPECFTC-GQCGKIFGNRPFFLEDGNAYCEADWNELFTTKCFACGFPV 2147

  Fly   134 T--DSAVLAMNVKWHRDCFRCNKCENPITSQTFTIDGDKPVC 173
            .  |..|.|:|..:|..||.|..|:..:..|:|...|.:|.|
  Fly  2148 EAGDRWVEALNHNYHSQCFNCTFCKQNLEGQSFYNKGGRPFC 2189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_610098.1 LIM 126..176 CDD:259829 17/50 (34%)
LIM 7..58 CDD:413332 18/52 (35%)
LIM 66..118 CDD:413332 18/51 (35%)
Zasp52NP_001027420.2 PDZ_ZASP52-like 8..88 CDD:467281
DUF4749 150..>218 CDD:464948
LIM_ALP_like 282..333 CDD:188746
PHA03247 <762..1006 CDD:223021
LIM1_Enigma_like_1 2020..2073 CDD:188839 18/52 (35%)
LIM 2081..2132 CDD:259829 18/51 (35%)
LIM3_Enigma_like_1 2140..2193 CDD:188845 17/50 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.