DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31937 and AT3G03330

Sequence 1:NP_608616.2 Gene:CG31937 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_186983.2 Gene:AT3G03330 AraportID:AT3G03330 Length:328 Species:Arabidopsis thaliana

Alignment Length:303 Identity:96/304 (32%)
Similarity:158/304 (52%) Gaps:37/304 (12%)


  Fly     9 LLLVLYYVVYVLLWILL-------DCNVALWYKSRFGVSLSSMRGQVVWITGASSGIGRALALSL 66
            :|.:|::.:..||.|:|       |.:..|..|..  |...:::|:||||||||.|||..||...
plant     1 MLTLLFFSLGALLLIVLLFKFAFADGDFTLISKKH--VKREAIQGKVVWITGASRGIGEILAKQF 63

  Fly    67 ARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMDMLDLDEHKTH-LNTVLNHF--H 128
            |....||:||||...:|::|:.|    .:|..|.:||.|:.:|:...:|...| :...::.|  .
plant    64 ASLDAKLILSARNKAELDRVKSE----LKGKFAPEDVKVLPLDLASGEESLKHVVEQAVSLFPGA 124

  Fly   129 RLDVLVNNAG-RSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSIA 192
            .:|.||:||. ...::..::...|..:..|:::||..:.|::||..:.::|.|  ||....||.|
plant   125 GVDYLVHNAAFERPKSKASDASEETLKTTFDVNVFGTISLTKLVAPHMLKQGG--GHFVVISSAA 187

  Fly   193 GFSPVPFSPTYCAAKHALNAYLLSLKVE--MRKLDVSLFAPGPIATDFLQEAFTGSQGGKVGLST 255
            |..|.|....|.|:||||:.|..||:.|  .:.:.|::..||||      |.:.|:     |.||
plant   188 GKVPSPGQAIYSASKHALHGYFHSLRSEFCQKGIKVTVVCPGPI------ETWNGT-----GTST 241

  Fly   256 AN-----QKRMTAQRCGDLFAVALANKMDLTWCGLFPVNLLAY 293
            :.     :||::::||.:|..:|.::.:...|....||.|:.|
plant   242 SEDSKSPEKRVSSERCAELTIIAASHNLKEAWISYQPVLLVMY 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 85/260 (33%)
adh_short 47..245 CDD:278532 70/204 (34%)
AT3G03330NP_186983.2 DltE 39..304 CDD:223377 86/264 (33%)
11beta-HSD1_like_SDR_c 41..296 CDD:187593 86/262 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H9350
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D906746at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_131445
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
65.830

Return to query results.
Submit another query.