DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31937 and dhrs7b

Sequence 1:NP_608616.2 Gene:CG31937 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_012825988.1 Gene:dhrs7b XenbaseID:XB-GENE-946473 Length:323 Species:Xenopus tropicalis

Alignment Length:316 Identity:97/317 (31%)
Similarity:149/317 (47%) Gaps:29/317 (9%)


  Fly     7 LLLLLVLYYVVYVLLWILLDCNVALWYKSRFGVSLSSMRGQVVWITGASSGIGRALALSLARHGV 71
            |||..:..|.:|.||           .:.|.|..|   :..||.||||:||:||..|......|.
 Frog    25 LLLGSIGVYSLYKLL-----------QRLRSGAYL---QDAVVVITGATSGLGRECAKVFYAAGT 75

  Fly    72 KLVLSARRLEQLEQ-VQEECLAAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNHFHRLDVLVN 135
            :|||..|..|.|:. |||......:.....|..:|| .|:.|::...:..|.:|:...|:|:|:|
 Frog    76 RLVLCGRSEEGLKNLVQELSQMRIKSAQLHKPHMVI-FDLSDVEAVNSAANEILHLTGRVDILIN 139

  Fly   136 NAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSIAGFSPVPFS 200
            |||.|.|.:..:.::.|||.:.:.:.|..|.|::.::...::..  ||||...||:.|...:||.
 Frog   140 NAGISYRGTILDTKVSVDRMVMDTNYFGPVALTKALIPSMIKNR--RGHIVVISSVQGKISIPFR 202

  Fly   201 PTYCAAKHALNAYLLSLKVEMR--KLDVSLFAPGPIATDFLQEAFTGSQGGKVGLSTAN--QKRM 261
            ..|.|:|||..|:...|:.||.  ::||::..||.|.|:....|.|| .|...|:...|  :.|.
 Frog   203 SAYSASKHATQAFFDCLRAEMSPYEIDVTVVNPGYIKTNLSLNAVTG-DGSNYGVMDNNTAEGRT 266

  Fly   262 TAQRCGDLFAVALANKMDLTWCGLFPVNLLAYCARN--PTL--SKILAQLMTEKTL 313
            ..:....:.......:.:|...||.|.  ||...|.  ||:  |.:.|:...|:.|
 Frog   267 PEEVAQTVLRAVGERRKELLVAGLVPT--LAVYLRTLAPTIFFSFMAARAKKERKL 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 80/254 (31%)
adh_short 47..245 CDD:278532 69/201 (34%)
dhrs7bXP_012825988.1 11beta-HSD1_like_SDR_c 48..309 CDD:187593 85/270 (31%)
PRK06181 52..319 CDD:235726 86/273 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D429842at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.