DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31937 and dhrs7

Sequence 1:NP_608616.2 Gene:CG31937 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001038811.1 Gene:dhrs7 ZFINID:ZDB-GENE-060825-21 Length:338 Species:Danio rerio

Alignment Length:312 Identity:116/313 (37%)
Similarity:177/313 (57%) Gaps:9/313 (3%)


  Fly    13 LYYVVYVLLWILLDCNVALWYKSRFG-VSLSSMRGQVVWITGASSGIGRALALSLARHGVKLVLS 76
            :|.:|..:.:|..|.::.|.:.:||| ...|:.||:||||||||||||..|:|.||..|.:||||
Zfish    15 VYLLVQFIRFIFADADLTLLWAARFGKTPESTFRGKVVWITGASSGIGEELSLQLAAIGARLVLS 79

  Fly    77 ARRLEQLEQVQEECLAAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQ 141
            |||..:||:|:..||  .|..|..:|:||:.:|::|...|.......|.||..:|||:||.||||
Zfish    80 ARRENELERVKRLCL--ERSSLKAEDILVLPLDLMDRASHPEKTTAALEHFGEIDVLINNGGRSQ 142

  Fly   142 RASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAA 206
            ||...:.:::|.:.|.||:....|.:::.|:.:.:::  |.|.||..||:|||..||.:..|.|:
Zfish   143 RALCVDADVDVYQALMELNYLGTVSITKQVLPHMIQR--GTGIIATVSSVAGFVGVPLATGYAAS 205

  Fly   207 KHALNAYLLSLKVEMR---KLDVSLFAPGPIATDFLQEAFTGSQGGKVGLSTANQKRMTAQRCGD 268
            ||||..:..||:.|:.   .:.:|...|||:.:..:|.|||...|..|..:.....:|:.:||..
Zfish   206 KHALQGFFNSLRTELSDCPNILISNICPGPVISSIVQNAFTEELGKPVATAGDQTHKMSTERCVH 270

  Fly   269 LFAVALANKMDLTWCGLFPVNLLAYCAR-NPTLSKILAQLMTEKTLNKIREG 319
            |..|.|||::...|....|..|..|..: .|||:..|..::.:|.:...:.|
Zfish   271 LTLVGLANRVKEMWIAEQPFLLFCYVWQYTPTLAWYLTNVLGKKRVQNFKAG 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 100/252 (40%)
adh_short 47..245 CDD:278532 85/201 (42%)
dhrs7NP_001038811.1 11beta-HSD1_like_SDR_c 47..307 CDD:187593 104/264 (39%)
adh_short 50..249 CDD:278532 85/203 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C255474575
eggNOG 1 0.900 E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H9350
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D429842at33208
OrthoFinder 1 1.000 FOG0006415
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_131445
Panther 1 1.100 LDO PTHR44269
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.