DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31937 and dhrs7cb

Sequence 1:NP_608616.2 Gene:CG31937 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001018493.1 Gene:dhrs7cb ZFINID:ZDB-GENE-050522-226 Length:324 Species:Danio rerio

Alignment Length:221 Identity:55/222 (25%)
Similarity:106/222 (48%) Gaps:15/222 (7%)


  Fly     8 LLLLVLYYVVYVLLWILLDCNVALWYKSRFGVSLSSMRGQVVWITGASSGIGRALALSLARHGVK 72
            ||::|...|.||...::           || :|.|.:|.:||.||.|.||:|...|......|.:
Zfish    11 LLIVVFAGVYYVYNEVM-----------RF-MSKSVVRNKVVVITDAVSGMGSECARLFHAGGAR 63

  Fly    73 LVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNHFHRLDVLVNNA 137
            |||.....::||.:.:. |.:......|....::.:|..|::.....::.:...:..:|||:.|:
Zfish    64 LVLCGPSWDKLESLYDS-LCSGSDPSQTFTPKLVLLDFSDMENISDVVSEICECYGCVDVLICNS 127

  Fly   138 GRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSIAGFSPVPFSPT 202
            ....:|....:.:|:|:.:.:::.|..:.|::.|:...:.:.  .|.....:||.|...:||...
Zfish   128 SMKVKAPVQNLSLEMDKTIMDVNYFGPITLAKGVLPLMITRR--TGQFVLVNSIQGKLALPFRTC 190

  Fly   203 YCAAKHALNAYLLSLKVEMRKLDVSL 228
            |.|:|||:.|:...|:.|:.:..:|:
Zfish   191 YAASKHAVQAFFDCLRAEVEEFGISV 216

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 45/186 (24%)
adh_short 47..245 CDD:278532 44/183 (24%)
dhrs7cbNP_001018493.1 11beta-HSD1_like_SDR_c 35..309 CDD:187593 45/186 (24%)
adh_short 38..219 CDD:278532 44/183 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D429842at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.