DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and zgc:109982

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001018379.1 Gene:zgc:109982 / 553564 ZFINID:ZDB-GENE-050522-139 Length:318 Species:Danio rerio


Alignment Length:231 Identity:68/231 - (29%)
Similarity:119/231 - (51%) Gaps:20/231 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 MRGQVVWITGASSGIGRALALSLARHGVK--LVLSARRLEQLEQVQEECLAAARGLLATKDVLVI 106
            |..:||.|||.|||||.:||:.:|....|  :|.:..|    ...:.|.|..|.|....:.:.:.
Zfish     1 MNQKVVLITGCSSGIGLSLAVRIANDEKKRFMVYATMR----NTAKAEALKEAAGQTLGQTLEIK 61

  Fly   107 QMDMLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLV 171
            |:|:.|.:..:..::::  ...::|:|::|||...........||..:.:.:.:.|.:|.|.::|
Zfish    62 QLDVCDENSIRACVDSL--PMGKIDILISNAGVGMIGPVECQTIEEMKSVMDTNFFGLVRLLKVV 124

  Fly   172 VRYFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAAKHALNAYLLSLKVE-MR-KLDVSLFAPGPI 234
            :.....:..  |||...|||.|...:.|:..|.|:|.|:..:..||.|: || .|::||..|||:
Zfish   125 LPDMKRRKS--GHIVVISSIMGIQGILFNDIYAASKFAVEGFCESLAVQAMRFNLNISLIEPGPV 187

  Fly   235 ATDFLQEAFTGSQGGKVGLSTANQKRMTAQRCGDLF 270
            .|:|.::.:  .:|.|:.||..:  ::||    |:|
Zfish   188 ITEFERKVY--EEGMKIDLSKVD--KVTA----DMF 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 68/231 (29%)
adh_short 47..245 CDD:278532 59/201 (29%)
zgc:109982NP_001018379.1 NADB_Rossmann 4..261 CDD:304358 67/228 (29%)
adh_short 4..198 CDD:278532 59/203 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.