DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31937 and dhrs7b

Sequence 1:NP_608616.2 Gene:CG31937 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_021326304.1 Gene:dhrs7b ZFINID:ZDB-GENE-050417-277 Length:316 Species:Danio rerio

Alignment Length:279 Identity:82/280 (29%)
Similarity:131/280 (47%) Gaps:16/280 (6%)


  Fly    43 SMRGQVVWITGASSGIGRALALSLARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQ 107
            :::.:||.|||||||:|:..|......|.:|:|..|...:|::|.||......|...|.....:.
Zfish    41 NIQDKVVVITGASSGLGKECARVFHAAGARLILCGRDQRRLQEVVEELRNKTYGKTQTYTPCTVT 105

  Fly   108 MDMLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVV 172
            .|:.:.....:....:|.....:|||:||||.|.|.:..:..:.|.||:.|.:.|..|.|::.::
Zfish   106 FDLSNTSVVCSAAAEILKCHGHIDVLINNAGVSYRGNILDTHVSVQREVMETNYFGPVALTQAIL 170

  Fly   173 RYFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAAKHALNAYLLSLKVEMRK--LDVSLFAPGPIA 235
            ...|::  |.|||...||:.|...:|:...|.|:|||:.||...|:.|:..  |.||:.:||.:.
Zfish   171 PSMVDR--GSGHIVVISSVQGKISIPYRSAYAASKHAMQAYYDCLRAEVDSLGLHVSVLSPGYVR 233

  Fly   236 TDFLQEAFTGSQGGKVGLSTANQKRMTAQRCG------DLFAVALANKMDLTWCGLFPVNLLAYC 294
            |:....|.|| .|.|.|:    ..|.||....      |:.......|.|:...||.|...:...
Zfish   234 TNMSINAVTG-DGSKYGV----MDRTTATGADPVDVAKDILKAVCQKKKDVVMAGLGPTTAIYLR 293

  Fly   295 ARNPTL-SKILAQLMTEKT 312
            ...|.| .:::|....::|
Zfish   294 TLWPALYFRVMASRARKQT 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 78/257 (30%)
adh_short 47..245 CDD:278532 65/200 (33%)
dhrs7bXP_021326304.1 11beta-HSD1_like_SDR_c 42..303 CDD:187593 80/268 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D429842at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.