DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31937 and dhrs7

Sequence 1:NP_608616.2 Gene:CG31937 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001015708.1 Gene:dhrs7 XenbaseID:XB-GENE-5838792 Length:336 Species:Xenopus tropicalis

Alignment Length:328 Identity:106/329 (32%)
Similarity:170/329 (52%) Gaps:14/329 (4%)


  Fly     1 MSFLEFLLLLL---VLYYVVYVLLWILLDCNVALWYKSRFG-VSLSSMRGQVVWITGASSGIGRA 61
            |.....|||||   :||:::.....|:.|.::.|.:....| ...|.:.|.|||:||||||||..
 Frog     1 MELASCLLLLLTGSLLYFLIQFFRLIMADSDLTLQWAEYCGHTPESKLGGNVVWVTGASSGIGEE 65

  Fly    62 LALSLARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNH 126
            |:..||:.|..||||:||..:|.:|:::||..:.  |..:|:|::.:||.....||......|.|
 Frog    66 LSYQLAKIGCPLVLSSRRETELLRVKQKCLEISS--LEDQDILILPLDMTQTSMHKEATEKALQH 128

  Fly   127 FHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSI 191
            |.|:|:||||||||||:.:.|..::|.|.|.||:....:.:::.|:::.:|:.  :|.|...||:
 Frog   129 FGRIDILVNNAGRSQRSLFVETNLDVFRALIELNYLGTISITKHVLQHMIERK--QGKIVNISSV 191

  Fly   192 AGFSPVPFSPTYCAAKHALNAYLLSLKVEMR---KLDVSLFAPGPIATDFLQEAFTGSQGGKVGL 253
            .|....|.|..|.|:||||..:..||:.|:.   .:.:|...|||:.:..::.|.|........:
 Frog   192 VGLIGAPLSSGYSASKHALQGFFNSLRTELTAYPDIIISNICPGPVQSKIVENALTEECEKVQSI 256

  Fly   254 STANQKRMTAQRCGDLFAVALANKMDLTWCGLFPVNLLAY--CARNPTLSKILAQLMTEKTLNKI 316
            .|....:|...||..|..:...|.:...|....|. |:||  ....|:|:..:...:.|:.:...
 Frog   257 KTDQSHKMATSRCVRLILITAVNNIKEAWISCQPF-LMAYYLWQYTPSLAWWITAKVGERRIKNF 320

  Fly   317 REG 319
            :.|
 Frog   321 KSG 323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 88/252 (35%)
adh_short 47..245 CDD:278532 77/201 (38%)
dhrs7NP_001015708.1 11beta-HSD1_like_SDR_c 48..308 CDD:187593 91/265 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C255471110
eggNOG 1 0.900 E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H9350
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D429842at33208
OrthoFinder 1 1.000 FOG0006415
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.