DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31937 and hsd17b1

Sequence 1:NP_608616.2 Gene:CG31937 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_991147.2 Gene:hsd17b1 ZFINID:ZDB-GENE-040901-5 Length:293 Species:Danio rerio

Alignment Length:271 Identity:78/272 (29%)
Similarity:124/272 (46%) Gaps:34/272 (13%)


  Fly    44 MRGQVVWITGASSGIGRALALSLARH---GVKLVLSARRLEQLEQVQEECLAAARGLLATKDVL- 104
            |..:||.|||.|||||.:||:.||.:   ..|:..:.|.|::    ::..|.:.|||  .||.| 
Zfish     1 MEQKVVLITGCSSGIGLSLAVHLASNPAKAYKVYATMRNLDK----KQRLLESVRGL--HKDTLD 59

  Fly   105 VIQMDMLD----LDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVV 165
            ::|||:.|    ||..:....      .|:|:||.|||...........::..|.:.::::...:
Zfish    60 ILQMDVTDQQSILDAQRNVSE------GRIDILVCNAGVGLMGPLETHSLDTIRAILDVNLLGTI 118

  Fly   166 HLSRLVVRYFVEQNGGR-GHIAATSSIAGFSPVPFSPTYCAAKHALNAYLLSLKVEMR--KLDVS 227
               |.:..:..:....| |.|..|.|:.|...:||:..|||:|.|:.....||.:.::  .:.:|
Zfish   119 ---RTIQTFLPDMKKKRHGRILVTGSMGGLQGLPFNEVYCASKFAIEGACESLAILLQHFNIHIS 180

  Fly   228 LFAPGPIATDFLQEAFTGSQGGKVGLSTANQKRM---TAQRCGDLFAVALANKMDLTWCGLFPVN 289
            |...||:.||||........|.||....|:.:.:   ..|.|..:|..|..:..|     :..|.
Zfish   181 LIECGPVNTDFLMNLKRTEPGDKVLEVDAHTRSLYDQYLQHCQSVFQNAAQDTED-----IIQVY 240

  Fly   290 LLAYCARNPTL 300
            |.|..|:.|.|
Zfish   241 LEAMEAQTPFL 251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 75/263 (29%)
adh_short 47..245 CDD:278532 62/209 (30%)
hsd17b1NP_991147.2 SDR 4..257 CDD:330230 77/269 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.