DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31937 and Dhrs7

Sequence 1:NP_608616.2 Gene:CG31937 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001258323.1 Gene:Dhrs7 RGDID:1565002 Length:338 Species:Rattus norvegicus

Alignment Length:325 Identity:116/326 (36%)
Similarity:171/326 (52%) Gaps:19/326 (6%)


  Fly     5 EFLLLLLVLYYVVYVLLWIL----LDCNVAL----WYKSRFGVSLSSMRGQVVWITGASSGIGRA 61
            |.||.||.|..|:..|:..|    .|.::.|    |...|....|:.|   ||||||||||||..
  Rat     4 ELLLWLLALCAVILPLVQFLRFLRADADLTLLWAEWQGRRPEWELTDM---VVWITGASSGIGEE 65

  Fly    62 LALSLARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNH 126
            ||..|::.||.|||||||.::||:|:..||  ..|.|..||:||:.:|:.|...|:.....||..
  Rat    66 LAFQLSKLGVCLVLSARRGQELERVKRRCL--ENGNLKEKDILVLPLDLTDTSSHEAATKAVLQE 128

  Fly   127 FHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSI 191
            |.::|:||||.|||||:...|..:||.:||..|:....|.|::.|:.:.||:.  :|.|...:|:
  Rat   129 FGKIDILVNNGGRSQRSLVLETNLEVFKELMNLNYLGTVSLTKCVLPHMVERK--QGKIVTVNSL 191

  Fly   192 AGFSPVPFSPTYCAAKHALNAYLLSLKVEMRK---LDVSLFAPGPIATDFLQEAFTGSQGGKVGL 253
            ||.:.|..|..|||:||||..:..:|..|:.|   :.:....|||:.::.::.|.|......:..
  Rat   192 AGIASVSLSSGYCASKHALRGFFNALHSELGKYPGITLCNVYPGPVQSNVVKNALTEELTKPMRE 256

  Fly   254 STANQKRMTAQRCGDLFAVALANKMDLTWCGLFPVNLLAYCAR-NPTLSKILAQLMTEKTLNKIR 317
            :.....:|...||..|..:::||.:...|....|:.|.||..: .||.:..|...:.||.:...|
  Rat   257 NIDQSYKMPTSRCVRLMLISMANDLKEVWISDQPILLGAYIWQYMPTWALWLTCKLGEKRIQNFR 321

  Fly   318  317
              Rat   322  321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 95/252 (38%)
adh_short 47..245 CDD:278532 84/201 (42%)
Dhrs7NP_001258323.1 11beta-HSD1_like_SDR_c 48..308 CDD:187593 99/267 (37%)
adh_short 52..250 CDD:278532 84/202 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C255474777
eggNOG 1 0.900 E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H9350
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D429842at33208
OrthoFinder 1 1.000 FOG0006415
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_131445
Panther 1 1.100 LDO PTHR44269
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
98.810

Return to query results.
Submit another query.