DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31937 and dhs-30

Sequence 1:NP_608616.2 Gene:CG31937 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_510793.2 Gene:dhs-30 WormBaseID:WBGene00000993 Length:311 Species:Caenorhabditis elegans

Alignment Length:271 Identity:80/272 (29%)
Similarity:133/272 (49%) Gaps:22/272 (8%)


  Fly     8 LLLLVLYYVVYVLLWILLDCNVALWYKSRFGVSLSSMRGQVVWITGASSGIGRALALSLARHGVK 72
            |::.:..||.|.||..::        .....:....::.:||.|||||||:|::||..|.:.|.:
 Worm    17 LVVPLSLYVAYKLLNRII--------PGAHNLPKLDVKNKVVVITGASSGLGKSLAFELYKRGAQ 73

  Fly    73 LVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNHFHRLDVLVNNA 137
            ::|.||..|:|:::.||......  |...:.:....|:.|.::      .......|:|:|:|||
 Worm    74 VILLARSTEKLKEICEELKETFP--LNQNEPIYYYFDITDSEQ------APWAEIPRVDILINNA 130

  Fly   138 GRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSIAGFSPVPFSPT 202
            |.|.|.|..:..:|:.|:..|.:.|..||    |.:..:.:....|.|..||||.|...:|:..:
 Worm   131 GMSNRGSCQDTTMEIHRQAMETNYFGHVH----VTQALLSKLSPDGCIVVTSSIQGKVAIPYRGS 191

  Fly   203 YCAAKHALNAYLLSLKVEMRKLDVSLFAPGPIATDFLQEAFTGSQGGKVGLSTANQKR-MTAQRC 266
            |.|:||||..|...|:.|.:.|.:.:.:.|.|.|.|...|...| |..||:...|||: .|.:.|
 Worm   192 YGASKHALQGYFDCLRAEHKNLHILVVSAGYINTGFGSRALDPS-GKVVGVEDENQKKGYTPEHC 255

  Fly   267 GDLFAVALANK 277
            ..:.:.|:.::
 Worm   256 ARMISDAIRDR 266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 74/236 (31%)
adh_short 47..245 CDD:278532 64/198 (32%)
dhs-30NP_510793.2 NADB_Rossmann 45..291 CDD:304358 74/236 (31%)
PRK06181 47..290 CDD:235726 74/234 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D429842at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.