DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31937 and Y47G6A.21

Sequence 1:NP_608616.2 Gene:CG31937 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001021764.1 Gene:Y47G6A.21 WormBaseID:WBGene00021646 Length:255 Species:Caenorhabditis elegans

Alignment Length:226 Identity:63/227 (28%)
Similarity:114/227 (50%) Gaps:25/227 (11%)


  Fly    48 VVWITGASSGIGRALALSLARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMDMLD 112
            |..|||||||||:..||..|:...:|.|:.|..:.|::|...|:  :.|.::..|:|:..:::..
 Worm     3 VAIITGASSGIGKGTALLFAKKKYQLSLTGRNTDSLKEVAALCI--SEGAISADDILITAVELSS 65

  Fly   113 LDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVE 177
            .:..|..::..:..|.|:|.|:|:||..:.....:..|||..||..::|.:::.|:|..:.:.:.
 Worm    66 DEAPKAIVDATVQKFGRIDSLINSAGILRAGPVLDSGIEVYDELMNVNVRSLIRLTRAALPHIIT 130

  Fly   178 QNGGRGHIAATSSIAGFSPVPFSPT--YCAAKHALNAYLLSLKVEM--RKLDVSLFAPGPIATD- 237
            .   :|.:...|||.|  |.||:..  ||.:|.|::.:...|.:||  ..:.|:...||.|.|: 
 Worm   131 T---KGTVVNVSSING--PCPFAGVTYYCMSKSAVDQFTKCLALEMAPNGVRVNAVCPGVIVTNI 190

  Fly   238 -------------FLQEAFTGSQGGKVGLST 255
                         ||:::.|....|:.|.::
 Worm   191 HRASGQDEATYAAFLEKSKTTHALGRPGTTS 221

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 63/227 (28%)
adh_short 47..245 CDD:278532 61/215 (28%)
Y47G6A.21NP_001021764.1 FabG 1..249 CDD:223959 63/227 (28%)
NADB_Rossmann 3..252 CDD:304358 63/227 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2709
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.