DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31937 and rdh8

Sequence 1:NP_608616.2 Gene:CG31937 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_002934401.2 Gene:rdh8 XenbaseID:XB-GENE-984982 Length:181 Species:Xenopus tropicalis

Alignment Length:189 Identity:57/190 (30%)
Similarity:97/190 (51%) Gaps:12/190 (6%)


  Fly    41 LSSMRGQVVWITGASSGIGRALALSLARHGVK---LVLSARRLEQLEQVQEECLAAARGLLATKD 102
            ::|...:.|.:||.|||||..:|:.||:...:   ::.:.|.|.:..:::.|.     |....|.
 Frog     1 MASDSKKTVLVTGCSSGIGLKIAVQLAKDPQERYYVIATMRDLGKRGKLEAEV-----GESLNKT 60

  Fly   103 VLVIQMDMLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHL 167
            :.:.|:|:...|..|..|:.:  ....:|:||||||..|......:.:|..|::||.:.|.||||
 Frog    61 LEIRQLDVTKEDSVKQCLDAL--PCQTVDILVNNAGVGQIGPIESLSMEDMRKVFETNFFGVVHL 123

  Fly   168 SRLVVRYFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAAKHALNAYLLSLKVEMRKLDV 226
            .:.|:....::  |.|||...|||.|...|.|:..|.|:|.|:..:...|.|::.|.::
 Frog   124 IKEVLPGMKKR--GSGHIVVISSIIGLQGVIFNDIYAASKFAIEGFCECLAVQLLKFNI 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 56/187 (30%)
adh_short 47..245 CDD:278532 56/184 (30%)
rdh8XP_002934401.2 NADB_Rossmann 7..>180 CDD:304358 56/182 (31%)
adh_short 7..180 CDD:278532 56/182 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.